BLASTX nr result
ID: Coptis23_contig00037370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00037370 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15289.3| unnamed protein product [Vitis vinifera] 68 9e-10 ref|XP_002266698.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-10 ref|XP_003527053.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003523047.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003525037.1| PREDICTED: pentatricopeptide repeat-containi... 62 5e-08 >emb|CBI15289.3| unnamed protein product [Vitis vinifera] Length = 793 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +1 Query: 1 DMTFCGELMTITGHAAHAFLVSMPAAGLDGQNVRDHAS 114 DM FCGELM +TGH AH FL+SMPAAG DGQNVRDH S Sbjct: 686 DMGFCGELMAVTGHPAHMFLLSMPAAGPDGQNVRDHVS 723 >ref|XP_002266698.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750 [Vitis vinifera] Length = 875 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +1 Query: 1 DMTFCGELMTITGHAAHAFLVSMPAAGLDGQNVRDHAS 114 DM FCGELM +TGH AH FL+SMPAAG DGQNVRDH S Sbjct: 677 DMGFCGELMAVTGHPAHMFLLSMPAAGPDGQNVRDHVS 714 >ref|XP_003527053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Glycine max] Length = 882 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +1 Query: 1 DMTFCGELMTITGHAAHAFLVSMPAAGLDGQNVRDHAS 114 DM FC ELM ++GH AHAFL SMPAAG DGQNVRDH S Sbjct: 684 DMGFCCELMAVSGHPAHAFLQSMPAAGPDGQNVRDHVS 721 >ref|XP_003523047.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Glycine max] Length = 879 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +1 Query: 1 DMTFCGELMTITGHAAHAFLVSMPAAGLDGQNVRDHAS 114 DM FC ELM ++GH AHAFL SMPAAG DGQNVRDH S Sbjct: 681 DMGFCCELMAVSGHPAHAFLQSMPAAGPDGQNVRDHVS 718 >ref|XP_003525037.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Glycine max] Length = 873 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +1 Query: 1 DMTFCGELMTITGHAAHAFLVSMPAAGLDGQNVRDHAS 114 DM F ELM +TGH AHAFL+SMPAAG DGQNVRDH S Sbjct: 675 DMGFFCELMAVTGHPAHAFLLSMPAAGPDGQNVRDHVS 712