BLASTX nr result
ID: Coptis23_contig00037352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00037352 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia mul... 111 5e-23 ref|ZP_20468564.1| hypothetical protein NM4119_1450, partial [Ne... 102 2e-20 ref|ZP_15989554.1| cell wall-associated hydrolase [Neisseria men... 102 2e-20 ref|ZP_10116778.1| hypothetical protein BD31_I1797 [Candidatus N... 102 2e-20 ref|ZP_20455168.1| hypothetical protein NMM7124_0419 [Neisseria ... 98 8e-19 >dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia multivorans ATCC 17616] Length = 234 Score = 111 bits (278), Expect = 5e-23 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = +1 Query: 1 LLSHLLDLSVSQLSTLMPLHYRHDVRP*LAYLRTPPLRFGRRPPQSNCPPCTVPNPDSG 177 LLSHLLDLSVSQLSTLMPLHY+HD RP LAYLRTPPL FGRRPPQSNC PCTVP+PD G Sbjct: 125 LLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRTPPLPFGRRPPQSNCLPCTVPDPDHG 183 >ref|ZP_20468564.1| hypothetical protein NM4119_1450, partial [Neisseria meningitidis 4119] gi|432246211|gb|ELL01666.1| hypothetical protein NM4119_1450, partial [Neisseria meningitidis 4119] Length = 156 Score = 102 bits (255), Expect = 2e-20 Identities = 48/60 (80%), Positives = 52/60 (86%) Frame = +1 Query: 1 LLSHLLDLSVSQLSTLMPLHYRHDVRP*LAYLRTPPLRFGRRPPQSNCPPCTVPNPDSGT 180 LLSHLLDLSVSQLS L+PLHY+ D RP L LRTPPLRFGRRPPQSNC PCTVP+PD G+ Sbjct: 65 LLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGS 124 >ref|ZP_15989554.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gi|421545340|ref|ZP_15991404.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gi|421551535|ref|ZP_15997524.1| cell wall-associated hydrolase [Neisseria meningitidis 69166] gi|433481109|ref|ZP_20438380.1| hypothetical protein NM2006087_0256 [Neisseria meningitidis 2006087] gi|433509806|ref|ZP_20466667.1| hypothetical protein NM12888_1665 [Neisseria meningitidis 12888] gi|402321417|gb|EJU56892.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gi|402326573|gb|EJU61973.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gi|402327151|gb|EJU62544.1| cell wall-associated hydrolase [Neisseria meningitidis 69166] gi|432218688|gb|ELK74541.1| hypothetical protein NM2006087_0256 [Neisseria meningitidis 2006087] gi|432245516|gb|ELL00985.1| hypothetical protein NM12888_1665 [Neisseria meningitidis 12888] Length = 202 Score = 102 bits (255), Expect = 2e-20 Identities = 48/60 (80%), Positives = 52/60 (86%) Frame = +1 Query: 1 LLSHLLDLSVSQLSTLMPLHYRHDVRP*LAYLRTPPLRFGRRPPQSNCPPCTVPNPDSGT 180 LLSHLLDLSVSQLS L+PLHY+ D RP L LRTPPLRFGRRPPQSNC PCTVP+PD G+ Sbjct: 111 LLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDPDDGS 170 >ref|ZP_10116778.1| hypothetical protein BD31_I1797 [Candidatus Nitrosopumilus salaria BD31] gi|386807662|gb|EIJ67033.1| hypothetical protein BD31_I1797 [Candidatus Nitrosopumilus salaria BD31] Length = 179 Score = 102 bits (255), Expect = 2e-20 Identities = 48/59 (81%), Positives = 51/59 (86%) Frame = +1 Query: 1 LLSHLLDLSVSQLSTLMPLHYRHDVRP*LAYLRTPPLRFGRRPPQSNCPPCTVPNPDSG 177 LLSHLLDLSVSQ S LMPLHY++D RP L YLRTPPL FGRRPPQSNCPP TVP+PD G Sbjct: 104 LLSHLLDLSVSQSSNLMPLHYQYDFRPYLGYLRTPPLLFGRRPPQSNCPPYTVPDPDYG 162 >ref|ZP_20455168.1| hypothetical protein NMM7124_0419 [Neisseria meningitidis M7124] gi|432236434|gb|ELK92041.1| hypothetical protein NMM7124_0419 [Neisseria meningitidis M7124] Length = 167 Score = 97.8 bits (242), Expect = 8e-19 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = +1 Query: 1 LLSHLLDLSVSQLSTLMPLHYRHDVRP*LAYLRTPPLRFGRRPPQSNCPPCTVPNP 168 LLSHLLDLSVSQLS L+PLHY+ D RP L LRTPPLRFGRRPPQSNC PCTVP+P Sbjct: 111 LLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPCTVPDP 166