BLASTX nr result
ID: Coptis23_contig00037111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00037111 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA41624.1| TPA: hypothetical protein ZEAMMB73_684695 [Zea m... 64 1e-08 ref|XP_002463293.1| hypothetical protein SORBIDRAFT_02g041380 [S... 64 1e-08 gb|EEC82565.1| hypothetical protein OsI_27112 [Oryza sativa Indi... 64 1e-08 gb|AAG52461.1|AC010852_18 putative RING zinc finger protein; 222... 63 3e-08 ref|XP_003562554.1| PREDICTED: mitochondrial ubiquitin ligase ac... 63 3e-08 >tpg|DAA41624.1| TPA: hypothetical protein ZEAMMB73_684695 [Zea mays] Length = 343 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -2 Query: 96 YLYAFFRCGHMCCCMTCSSHLTSCPLCRRRID 1 Y F CGHMCCCM CSSHLT+CPLCRRRID Sbjct: 304 YNAVFVPCGHMCCCMACSSHLTNCPLCRRRID 335 >ref|XP_002463293.1| hypothetical protein SORBIDRAFT_02g041380 [Sorghum bicolor] gi|241926670|gb|EER99814.1| hypothetical protein SORBIDRAFT_02g041380 [Sorghum bicolor] Length = 343 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -2 Query: 96 YLYAFFRCGHMCCCMTCSSHLTSCPLCRRRID 1 Y F CGHMCCCM CSSHLT+CPLCRRRID Sbjct: 304 YNAVFVPCGHMCCCMACSSHLTNCPLCRRRID 335 >gb|EEC82565.1| hypothetical protein OsI_27112 [Oryza sativa Indica Group] gi|222637570|gb|EEE67702.1| hypothetical protein OsJ_25368 [Oryza sativa Japonica Group] Length = 343 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -2 Query: 96 YLYAFFRCGHMCCCMTCSSHLTSCPLCRRRID 1 Y F CGHMCCCM CSSHLT+CPLCRRRID Sbjct: 304 YNAVFVPCGHMCCCMNCSSHLTNCPLCRRRID 335 >gb|AAG52461.1|AC010852_18 putative RING zinc finger protein; 22238-21626 [Arabidopsis thaliana] gi|66865910|gb|AAY57589.1| RING finger family protein [Arabidopsis thaliana] Length = 115 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -2 Query: 96 YLYAFFRCGHMCCCMTCSSHLTSCPLCRRRID 1 Y F CGHMCCC CSSHLTSCPLCRRRID Sbjct: 76 YNAVFVPCGHMCCCTACSSHLTSCPLCRRRID 107 >ref|XP_003562554.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform 2 [Brachypodium distachyon] Length = 331 Score = 62.8 bits (151), Expect = 3e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 96 YLYAFFRCGHMCCCMTCSSHLTSCPLCRRRID 1 Y F CGHMCCCM CSSH+T+CPLCRRRID Sbjct: 292 YNAVFVPCGHMCCCMNCSSHVTNCPLCRRRID 323