BLASTX nr result
ID: Coptis23_contig00036873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036873 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520305.1| ATP binding protein, putative [Ricinus commu... 60 2e-07 ref|XP_002310531.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 gb|AAC34357.1| Putative protein kinase [Arabidopsis thaliana] 55 8e-06 ref|NP_177852.2| adenine nucleotide alpha hydrolases-domain cont... 55 8e-06 >ref|XP_002520305.1| ATP binding protein, putative [Ricinus communis] gi|223540524|gb|EEF42091.1| ATP binding protein, putative [Ricinus communis] Length = 758 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 DVEDDSLSISSIEQGLSIESYLQGRCSRSSSFD 99 DVEDDSLSISSIEQ +S+E YLQGRCSRSSSFD Sbjct: 726 DVEDDSLSISSIEQTVSLEDYLQGRCSRSSSFD 758 >ref|XP_002310531.1| predicted protein [Populus trichocarpa] gi|222853434|gb|EEE90981.1| predicted protein [Populus trichocarpa] Length = 720 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 1 DVEDDSLSISSIEQGLSIESYLQGRCSRSSSFD 99 D+EDDSLSISS EQG+S+E YLQGR SR+SSFD Sbjct: 688 DLEDDSLSISSTEQGVSVEDYLQGRWSRTSSFD 720 >gb|AAC34357.1| Putative protein kinase [Arabidopsis thaliana] Length = 781 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 DVEDDSLSISSIEQGLSIESYLQGRCSRSSSFD 99 DVEDDS+S+ SIEQG+S+E YL+GR SRSSSFD Sbjct: 749 DVEDDSISMGSIEQGVSVEDYLKGRTSRSSSFD 781 >ref|NP_177852.2| adenine nucleotide alpha hydrolases-domain containing protein kinase [Arabidopsis thaliana] gi|332197836|gb|AEE35957.1| adenine nucleotide alpha hydrolases-domain containing protein kinase [Arabidopsis thaliana] Length = 794 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 DVEDDSLSISSIEQGLSIESYLQGRCSRSSSFD 99 DVEDDS+S+ SIEQG+S+E YL+GR SRSSSFD Sbjct: 762 DVEDDSISMGSIEQGVSVEDYLKGRTSRSSSFD 794