BLASTX nr result
ID: Coptis23_contig00036407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036407 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001754127.1| predicted protein [Physcomitrella patens sub... 56 3e-06 ref|XP_001780774.1| predicted protein [Physcomitrella patens sub... 56 3e-06 >ref|XP_001754127.1| predicted protein [Physcomitrella patens subsp. patens] gi|162694681|gb|EDQ81028.1| predicted protein [Physcomitrella patens subsp. patens] Length = 428 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 226 QVQKTVCDKYDTEFYPRYKKWCDDYLFLLRH 134 Q QK CDK+D EFYP+YKKWCDDY FL++H Sbjct: 273 QTQKDACDKHDPEFYPKYKKWCDDY-FLIKH 302 >ref|XP_001780774.1| predicted protein [Physcomitrella patens subsp. patens] gi|162667792|gb|EDQ54413.1| predicted protein [Physcomitrella patens subsp. patens] Length = 315 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 226 QVQKTVCDKYDTEFYPRYKKWCDDYLFLLRH 134 QVQK CDK+D EFYP++KKWCDDY FL++H Sbjct: 157 QVQKQACDKHDPEFYPKFKKWCDDY-FLIKH 186