BLASTX nr result
ID: Coptis23_contig00036389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036389 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD66788.1| orf184 [Beta vulgaris subsp. vulgaris] 70 8e-12 >dbj|BAD66788.1| orf184 [Beta vulgaris subsp. vulgaris] Length = 184 Score = 70.1 bits (170), Expect(2) = 8e-12 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 212 MKRLLHNFIIRSGTSPLFFGRKGYPSLSSTEEPAFDS 102 MKRLLHN IRSGT PLFFGRKGYPSLSST+EPAFDS Sbjct: 1 MKRLLHNLKIRSGTYPLFFGRKGYPSLSSTDEPAFDS 37 Score = 24.6 bits (52), Expect(2) = 8e-12 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 63 RFDPSPDQIRVP 28 RFDPSPDQI P Sbjct: 50 RFDPSPDQILNP 61