BLASTX nr result
ID: Coptis23_contig00036329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036329 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271842.1| PREDICTED: uncharacterized protein LOC100252... 91 1e-16 ref|XP_002526725.1| conserved hypothetical protein [Ricinus comm... 84 9e-15 ref|XP_004158546.1| PREDICTED: uncharacterized LOC101219073 [Cuc... 83 3e-14 ref|XP_004138819.1| PREDICTED: uncharacterized protein LOC101219... 83 3e-14 ref|XP_002520663.1| conserved hypothetical protein [Ricinus comm... 82 3e-14 >ref|XP_002271842.1| PREDICTED: uncharacterized protein LOC100252260 [Vitis vinifera] Length = 365 Score = 90.5 bits (223), Expect = 1e-16 Identities = 46/88 (52%), Positives = 60/88 (68%) Frame = +3 Query: 3 AKKLHFKTTSRPDSVLKLFHDYGFTKTQITNLVIKRPNLILSNPHKTLEPKLQILKQVGF 182 A+KL+ KTT+RPDSV++LF YGFT T I +V K P+L+L+NP KTL PKLQ L G Sbjct: 48 AEKLNIKTTTRPDSVVQLFKSYGFTPTHIATIVSKLPSLLLANPVKTLAPKLQFLSNNGV 107 Query: 183 SGHELGKLLLQDPFYFYISLQNRIIPSL 266 SG L ++ +P SLQN+IIP + Sbjct: 108 SGSSLVNIVSTNPVILRRSLQNQIIPCI 135 >ref|XP_002526725.1| conserved hypothetical protein [Ricinus communis] gi|223533914|gb|EEF35639.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/87 (45%), Positives = 57/87 (65%) Frame = +3 Query: 3 AKKLHFKTTSRPDSVLKLFHDYGFTKTQITNLVIKRPNLILSNPHKTLEPKLQILKQVGF 182 +K LHFKT PDSVL F +GF+KTQIT +V +RP+++ SNP KTL PK+Q G Sbjct: 121 SKYLHFKTPDGPDSVLSFFKSHGFSKTQITKVVHRRPSVLSSNPEKTLLPKIQFFHSKGL 180 Query: 183 SGHELGKLLLQDPFYFYISLQNRIIPS 263 S ++ K+L P + S +N++IP+ Sbjct: 181 SSPDIAKILSACPEILHTSTENQLIPA 207 >ref|XP_004158546.1| PREDICTED: uncharacterized LOC101219073 [Cucumis sativus] Length = 373 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/86 (45%), Positives = 58/86 (67%) Frame = +3 Query: 3 AKKLHFKTTSRPDSVLKLFHDYGFTKTQITNLVIKRPNLILSNPHKTLEPKLQILKQVGF 182 AKK+H K +S PDSVL LF+ YGFT +Q N+ ++P L+L++P KTL+PK + L + G Sbjct: 69 AKKIHLKPSSDPDSVLALFNAYGFTPSQTANIFCRQPRLLLADPDKTLKPKFEFLSKNGI 128 Query: 183 SGHELGKLLLQDPFYFYISLQNRIIP 260 SG+ L L+ ++P SL +I+P Sbjct: 129 SGNFLVDLICREPHILRRSLDKKIVP 154 >ref|XP_004138819.1| PREDICTED: uncharacterized protein LOC101219073 [Cucumis sativus] Length = 382 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/86 (45%), Positives = 58/86 (67%) Frame = +3 Query: 3 AKKLHFKTTSRPDSVLKLFHDYGFTKTQITNLVIKRPNLILSNPHKTLEPKLQILKQVGF 182 AKK+H K +S PDSVL LF+ YGFT +Q N+ ++P L+L++P KTL+PK + L + G Sbjct: 66 AKKIHLKPSSDPDSVLALFNAYGFTPSQTANIFCRQPRLLLADPDKTLKPKFEFLSKNGI 125 Query: 183 SGHELGKLLLQDPFYFYISLQNRIIP 260 SG+ L L+ ++P SL +I+P Sbjct: 126 SGNFLVDLICREPHILRRSLDKKIVP 151 >ref|XP_002520663.1| conserved hypothetical protein [Ricinus communis] gi|223540048|gb|EEF41625.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/87 (44%), Positives = 59/87 (67%) Frame = +3 Query: 3 AKKLHFKTTSRPDSVLKLFHDYGFTKTQITNLVIKRPNLILSNPHKTLEPKLQILKQVGF 182 ++K+H ++ R D+VL L D GFTKTQI++LV KRP+L+L++ H TL PKL+ +G Sbjct: 58 SQKVHLESPKRADTVLALLKDRGFTKTQISSLVKKRPSLLLAHAHNTLLPKLEFFYSIGV 117 Query: 183 SGHELGKLLLQDPFYFYISLQNRIIPS 263 S +L + L DP S++N+I+PS Sbjct: 118 SSSDLARTLSSDPTLLTRSIENQIVPS 144