BLASTX nr result
ID: Coptis23_contig00036154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036154 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522229.1| conserved hypothetical protein [Ricinus comm... 121 5e-26 ref|XP_002316818.1| predicted protein [Populus trichocarpa] gi|2... 118 4e-25 ref|XP_004161210.1| PREDICTED: DUF246 domain-containing protein ... 116 2e-24 ref|XP_004150223.1| PREDICTED: DUF246 domain-containing protein ... 116 2e-24 gb|AAT64033.1| putative growth regulator [Gossypium hirsutum] 114 1e-23 >ref|XP_002522229.1| conserved hypothetical protein [Ricinus communis] gi|223538482|gb|EEF40087.1| conserved hypothetical protein [Ricinus communis] Length = 598 Score = 121 bits (304), Expect = 5e-26 Identities = 55/64 (85%), Positives = 61/64 (95%) Frame = +2 Query: 32 ITDSDIVKEAKPTDFIKRVLPLLQQNGVVHLLGFGNRLGFDPMPHELQRLRCKCNFHALK 211 ITD+DI KEAKPTD++++VLPLL QNGVVHLLGFGNRLGFDPMP +LQRLRCKCNFHALK Sbjct: 282 ITDADIAKEAKPTDYLEKVLPLLLQNGVVHLLGFGNRLGFDPMPSKLQRLRCKCNFHALK 341 Query: 212 FVPK 223 FVPK Sbjct: 342 FVPK 345 >ref|XP_002316818.1| predicted protein [Populus trichocarpa] gi|222859883|gb|EEE97430.1| predicted protein [Populus trichocarpa] Length = 426 Score = 118 bits (296), Expect = 4e-25 Identities = 54/71 (76%), Positives = 62/71 (87%) Frame = +2 Query: 11 ISSLSVQITDSDIVKEAKPTDFIKRVLPLLQQNGVVHLLGFGNRLGFDPMPHELQRLRCK 190 I ++ ITD+DIVKEAKP D++ +VLPLL QNGVVHLLGFGNRLGFDP+P LQ+LRCK Sbjct: 78 IEAIGSLITDADIVKEAKPIDYLTKVLPLLLQNGVVHLLGFGNRLGFDPLPSRLQKLRCK 137 Query: 191 CNFHALKFVPK 223 CNFHALKFVPK Sbjct: 138 CNFHALKFVPK 148 >ref|XP_004161210.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 630 Score = 116 bits (290), Expect = 2e-24 Identities = 53/71 (74%), Positives = 60/71 (84%) Frame = +2 Query: 11 ISSLSVQITDSDIVKEAKPTDFIKRVLPLLQQNGVVHLLGFGNRLGFDPMPHELQRLRCK 190 + ++ QITD DI KEAKPTD+I+ VLPLL QNGVVH LGFGNRLGFDP+P LQ+LRCK Sbjct: 281 LEAIGSQITDEDIAKEAKPTDYIRTVLPLLLQNGVVHFLGFGNRLGFDPIPFNLQKLRCK 340 Query: 191 CNFHALKFVPK 223 CNFHALKFV K Sbjct: 341 CNFHALKFVHK 351 >ref|XP_004150223.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 630 Score = 116 bits (290), Expect = 2e-24 Identities = 53/71 (74%), Positives = 60/71 (84%) Frame = +2 Query: 11 ISSLSVQITDSDIVKEAKPTDFIKRVLPLLQQNGVVHLLGFGNRLGFDPMPHELQRLRCK 190 + ++ QITD DI KEAKPTD+I+ VLPLL QNGVVH LGFGNRLGFDP+P LQ+LRCK Sbjct: 281 LEAIGSQITDEDIAKEAKPTDYIRTVLPLLLQNGVVHFLGFGNRLGFDPIPFNLQKLRCK 340 Query: 191 CNFHALKFVPK 223 CNFHALKFV K Sbjct: 341 CNFHALKFVHK 351 >gb|AAT64033.1| putative growth regulator [Gossypium hirsutum] Length = 598 Score = 114 bits (284), Expect = 1e-23 Identities = 53/71 (74%), Positives = 60/71 (84%) Frame = +2 Query: 11 ISSLSVQITDSDIVKEAKPTDFIKRVLPLLQQNGVVHLLGFGNRLGFDPMPHELQRLRCK 190 I ++ ITD+DIVKEAKP D+I+ VLPLL +N VVH LGFGNRLGFDP P ELQRLRCK Sbjct: 249 IETIGSLITDADIVKEAKPIDYIRTVLPLLMKNKVVHFLGFGNRLGFDPFPPELQRLRCK 308 Query: 191 CNFHALKFVPK 223 C+FHALKFVPK Sbjct: 309 CDFHALKFVPK 319