BLASTX nr result
ID: Coptis23_contig00036153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036153 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR18233.1| unknown [Picea sitchensis] 60 2e-07 ref|XP_002272019.1| PREDICTED: 2-aminoethanethiol dioxygenase [V... 59 3e-07 ref|XP_002280878.2| PREDICTED: 2-aminoethanethiol dioxygenase [V... 58 9e-07 emb|CBI21993.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_003539996.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 57 1e-06 >gb|ABR18233.1| unknown [Picea sitchensis] Length = 239 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 193 HAYLPRLIHVRFQARSLLLKRITLMEIGILCVPPSSIIPLHNHPGI-ILSKLLYGSLH 23 H Y+P + ++ + IGI C+PPSSIIPLHNHPG+ +LSKLLYGS+H Sbjct: 64 HRYMPPITYLH-------IHECERFSIGIFCMPPSSIIPLHNHPGMTVLSKLLYGSMH 114 >ref|XP_002272019.1| PREDICTED: 2-aminoethanethiol dioxygenase [Vitis vinifera] gi|297740513|emb|CBI30695.3| unnamed protein product [Vitis vinifera] Length = 244 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/33 (78%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = -3 Query: 115 IGILCVPPSSIIPLHNHPGI-ILSKLLYGSLHI 20 IGI C+PPSSIIPLHNHPG+ +LSKLLYG+LH+ Sbjct: 89 IGIFCMPPSSIIPLHNHPGMTVLSKLLYGTLHV 121 >ref|XP_002280878.2| PREDICTED: 2-aminoethanethiol dioxygenase [Vitis vinifera] Length = 240 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/33 (75%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = -3 Query: 115 IGILCVPPSSIIPLHNHPGI-ILSKLLYGSLHI 20 IG+ C+PPSSIIPLHNHPG+ +LSKLLYGSL++ Sbjct: 84 IGVFCMPPSSIIPLHNHPGMTVLSKLLYGSLYV 116 >emb|CBI21993.3| unnamed protein product [Vitis vinifera] Length = 239 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/33 (75%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = -3 Query: 115 IGILCVPPSSIIPLHNHPGI-ILSKLLYGSLHI 20 IG+ C+PPSSIIPLHNHPG+ +LSKLLYGSL++ Sbjct: 84 IGVFCMPPSSIIPLHNHPGMTVLSKLLYGSLYV 116 >ref|XP_003539996.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Length = 239 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/33 (75%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = -3 Query: 115 IGILCVPPSSIIPLHNHPGI-ILSKLLYGSLHI 20 IGI C+PPSSIIPLHNHPG+ +LSKLLYGS+++ Sbjct: 84 IGIFCMPPSSIIPLHNHPGMTVLSKLLYGSMYV 116