BLASTX nr result
ID: Coptis23_contig00036123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036123 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278197.1| PREDICTED: sugar transporter ERD6-like 16-li... 65 4e-09 emb|CAN63855.1| hypothetical protein VITISV_008852 [Vitis vinifera] 65 4e-09 ref|XP_003594043.1| Sugar transporter ERD6-like protein [Medicag... 55 5e-06 ref|XP_002516838.1| sugar transporter, putative [Ricinus communi... 55 8e-06 >ref|XP_002278197.1| PREDICTED: sugar transporter ERD6-like 16-like [Vitis vinifera] Length = 492 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/73 (49%), Positives = 48/73 (65%), Gaps = 8/73 (10%) Frame = +3 Query: 126 LGMAISEDVEKGGNRGLNAVRQPLIEREKTGAYD--------STIRSRSEGSIGMVLPST 281 +G+ EDVEKGG GL +++PL++ EK + S+ ++ S+GSI MVL ST Sbjct: 1 MGIHQREDVEKGGKNGLEDLKKPLVQGEKIIVSNELGCETDGSSSQNGSDGSIWMVLLST 60 Query: 282 LVAVCGSFEFGSC 320 VAVCGSFEFGSC Sbjct: 61 FVAVCGSFEFGSC 73 >emb|CAN63855.1| hypothetical protein VITISV_008852 [Vitis vinifera] Length = 561 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/73 (49%), Positives = 48/73 (65%), Gaps = 8/73 (10%) Frame = +3 Query: 126 LGMAISEDVEKGGNRGLNAVRQPLIEREKTGAYD--------STIRSRSEGSIGMVLPST 281 +G+ EDVEKGG GL +++PL++ EK + S+ ++ S+GSI MVL ST Sbjct: 1 MGIHQREDVEKGGKNGLEDLKKPLVQGEKIIVSNELGCETDGSSSQNGSDGSIWMVLLST 60 Query: 282 LVAVCGSFEFGSC 320 VAVCGSFEFGSC Sbjct: 61 FVAVCGSFEFGSC 73 >ref|XP_003594043.1| Sugar transporter ERD6-like protein [Medicago truncatula] gi|355483091|gb|AES64294.1| Sugar transporter ERD6-like protein [Medicago truncatula] Length = 485 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +3 Query: 144 EDVEKGGNRGLNAVRQPLIEREKTGAYD-STIRSRSEGSIGMVLPSTLVAVCGSFEFGSC 320 +D+E G G +++P I++ K + + +S GSIGMVL ST VAVCGSF FG+C Sbjct: 7 KDIENGETNGFQYLQEPFIQQGKDACKEVGSDKSMENGSIGMVLLSTFVAVCGSFSFGTC 66 >ref|XP_002516838.1| sugar transporter, putative [Ricinus communis] gi|223543926|gb|EEF45452.1| sugar transporter, putative [Ricinus communis] Length = 516 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 2/65 (3%) Frame = +3 Query: 132 MAISE--DVEKGGNRGLNAVRQPLIEREKTGAYDSTIRSRSEGSIGMVLPSTLVAVCGSF 305 MAI + D+E+G L + +PLI EK ++ + GS+ MVL ST VAVCGSF Sbjct: 1 MAIGQCKDIEQGEINDLQDLERPLIHEEKAVSFKND--EEENGSMNMVLLSTFVAVCGSF 58 Query: 306 EFGSC 320 EFGSC Sbjct: 59 EFGSC 63