BLASTX nr result
ID: Coptis23_contig00035908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035908 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588266.1| hypothetical protein MTR_1g005070 [Medicago ... 48 4e-11 >ref|XP_003588266.1| hypothetical protein MTR_1g005070 [Medicago truncatula] gi|355477314|gb|AES58517.1| hypothetical protein MTR_1g005070 [Medicago truncatula] Length = 110 Score = 47.8 bits (112), Expect(2) = 4e-11 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 125 MRDFCWIRSFALTEAFGPSEKD 190 MRDF WIRSFALTEAFGPSEKD Sbjct: 1 MRDFSWIRSFALTEAFGPSEKD 22 Score = 44.7 bits (104), Expect(2) = 4e-11 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = +3 Query: 195 SLRASKRERSKQSRSFARREARRGSGAVVEAVASPDRLQYKSR 323 SLRASKRERSKQSRSFAR + R+ S + + P + +Y S+ Sbjct: 25 SLRASKRERSKQSRSFARSKTRKQSCRISGSFPRPTKKKYNSQ 67