BLASTX nr result
ID: Coptis23_contig00035886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035886 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516868.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 emb|CBI26113.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002276706.1| PREDICTED: uncharacterized protein LOC100251... 60 2e-07 emb|CAN63394.1| hypothetical protein VITISV_001889 [Vitis vinifera] 58 9e-07 ref|XP_002311843.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002516868.1| conserved hypothetical protein [Ricinus communis] gi|223543956|gb|EEF45482.1| conserved hypothetical protein [Ricinus communis] Length = 287 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +2 Query: 17 VSPSLKGSESFHKFPYVIFCAPPSRTADYPSNVR 118 ++PSLKG++ H+FPYVIFCAPPSRT+DYP +VR Sbjct: 76 INPSLKGTKPIHQFPYVIFCAPPSRTSDYPGDVR 109 >emb|CBI26113.3| unnamed protein product [Vitis vinifera] Length = 410 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +2 Query: 17 VSPSLKGSESFHKFPYVIFCAPPSRTADYPSNVR 118 ++PSLKG ++ H+FPYVIFCAPPSRT+DYP++VR Sbjct: 191 INPSLKGVKTTHQFPYVIFCAPPSRTSDYPADVR 224 >ref|XP_002276706.1| PREDICTED: uncharacterized protein LOC100251108 [Vitis vinifera] Length = 343 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +2 Query: 17 VSPSLKGSESFHKFPYVIFCAPPSRTADYPSNVR 118 ++PSLKG ++ H+FPYVIFCAPPSRT+DYP++VR Sbjct: 127 INPSLKGVKTTHQFPYVIFCAPPSRTSDYPADVR 160 >emb|CAN63394.1| hypothetical protein VITISV_001889 [Vitis vinifera] Length = 297 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +2 Query: 17 VSPSLKGSESFHKFPYVIFCAPPSRTADYPSNVR 118 ++PSLKG ++ H+FPYVIFCAPPS T+DYP++VR Sbjct: 127 INPSLKGVKTTHQFPYVIFCAPPSXTSDYPADVR 160 >ref|XP_002311843.1| predicted protein [Populus trichocarpa] gi|222851663|gb|EEE89210.1| predicted protein [Populus trichocarpa] Length = 304 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = +2 Query: 17 VSPSLKGSESFHKFPYVIFCAPPSRTADYPSNVR 118 ++PSLKG+++ ++PYVIFCAPPSRT+DYP +VR Sbjct: 76 INPSLKGTKATQQYPYVIFCAPPSRTSDYPGDVR 109