BLASTX nr result
ID: Coptis23_contig00035670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035670 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26657.3| unnamed protein product [Vitis vinifera] 59 3e-07 ref|XP_002279440.1| PREDICTED: mutS protein homolog 5-like [Viti... 59 3e-07 >emb|CBI26657.3| unnamed protein product [Vitis vinifera] Length = 793 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 306 AKDQQYKEAVDKMLAFDATRGDLNLFFQDIFPS 208 A+DQ YK+AVDKMLAFD +GDLNLFFQDIFPS Sbjct: 761 AQDQLYKDAVDKMLAFDILKGDLNLFFQDIFPS 793 >ref|XP_002279440.1| PREDICTED: mutS protein homolog 5-like [Vitis vinifera] Length = 807 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 306 AKDQQYKEAVDKMLAFDATRGDLNLFFQDIFPS 208 A+DQ YK+AVDKMLAFD +GDLNLFFQDIFPS Sbjct: 775 AQDQLYKDAVDKMLAFDILKGDLNLFFQDIFPS 807