BLASTX nr result
ID: Coptis23_contig00035575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035575 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34943.1| unknown [Lotus japonicus] 72 5e-11 ref|XP_003542013.1| PREDICTED: probable calcium-binding protein ... 69 5e-10 ref|XP_002285886.1| PREDICTED: probable calcium-binding protein ... 68 9e-10 ref|XP_002520298.1| calcium binding protein/cast, putative [Rici... 67 1e-09 ref|NP_001236132.1| uncharacterized protein LOC100500561 [Glycin... 67 2e-09 >gb|AFK34943.1| unknown [Lotus japonicus] Length = 155 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/72 (47%), Positives = 49/72 (68%) Frame = -1 Query: 222 LAKMCLLNSSDLHKIFAKLDQNGDGHVSVEELRCFLAKVDVQIGLEELQAIVGREKFDLK 43 LA MCLL +DL +IF KLD NGDG +S+EEL L K + LEEL+++V ++ +L Sbjct: 3 LANMCLLTPNDLERIFEKLDMNGDGLLSLEELNHLLEKTGFKFSLEELESLVRKKSLNLS 62 Query: 42 EFILFCETIYKK 7 EF+ F +T+ K+ Sbjct: 63 EFLFFYDTMLKR 74 >ref|XP_003542013.1| PREDICTED: probable calcium-binding protein CML44-like [Glycine max] Length = 164 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/71 (43%), Positives = 47/71 (66%) Frame = -1 Query: 213 MCLLNSSDLHKIFAKLDQNGDGHVSVEELRCFLAKVDVQIGLEELQAIVGREKFDLKEFI 34 MC L SDL +IF K+D NGDG +S+EEL+ L K +EEL+++VG++ D EF+ Sbjct: 1 MCPLTPSDLKRIFNKVDMNGDGLLSLEELKMLLEKTGFSYSIEELESLVGKKSLDFSEFL 60 Query: 33 LFCETIYKKRS 1 F E++ K+ + Sbjct: 61 FFYESMLKQNN 71 >ref|XP_002285886.1| PREDICTED: probable calcium-binding protein CML44-like [Vitis vinifera] Length = 162 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/63 (52%), Positives = 45/63 (71%) Frame = -1 Query: 204 LNSSDLHKIFAKLDQNGDGHVSVEELRCFLAKVDVQIGLEELQAIVGREKFDLKEFILFC 25 L+S DLH+IF KLD+NGDG VS+ EL L +V VQ L+EL+++VG D EF++F Sbjct: 6 LSSIDLHRIFHKLDRNGDGLVSLGELNWLLERVGVQYSLDELESLVGNTTLDFNEFLVFY 65 Query: 24 ETI 16 E+I Sbjct: 66 ESI 68 >ref|XP_002520298.1| calcium binding protein/cast, putative [Ricinus communis] gi|223540517|gb|EEF42084.1| calcium binding protein/cast, putative [Ricinus communis] Length = 165 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/66 (48%), Positives = 43/66 (65%) Frame = -1 Query: 213 MCLLNSSDLHKIFAKLDQNGDGHVSVEELRCFLAKVDVQIGLEELQAIVGREKFDLKEFI 34 MC L + DLH+IF KLD+NGDG +S+ EL L K+ V EEL+ VG+ D EF+ Sbjct: 1 MCPLITRDLHRIFQKLDKNGDGLLSIGELNWLLEKIGVHFSPEELEGSVGKSSLDFNEFL 60 Query: 33 LFCETI 16 LF ++I Sbjct: 61 LFYDSI 66 >ref|NP_001236132.1| uncharacterized protein LOC100500561 [Glycine max] gi|255630633|gb|ACU15676.1| unknown [Glycine max] Length = 163 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/71 (43%), Positives = 46/71 (64%) Frame = -1 Query: 213 MCLLNSSDLHKIFAKLDQNGDGHVSVEELRCFLAKVDVQIGLEELQAIVGREKFDLKEFI 34 MC L SDL +IF K+D NGDG +S+EEL+ L K +EEL+++VG++ D EF+ Sbjct: 1 MCPLTPSDLLRIFEKVDMNGDGFLSLEELKMLLEKTGFGYSIEELESLVGKKSLDFSEFL 60 Query: 33 LFCETIYKKRS 1 F E+ K+ + Sbjct: 61 FFYESRLKQNN 71