BLASTX nr result
ID: Coptis23_contig00035474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035474 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20487.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002282842.1| PREDICTED: dihydroflavonol-4-reductase-like ... 58 7e-07 >emb|CBI20487.3| unnamed protein product [Vitis vinifera] Length = 313 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = -1 Query: 235 RSSEEQHKTIPSRISSKKLTDLGFEYKYGVGDVIKQSISSCMQHGLL 95 R EE+ + PS I SKKL DLGF YKYG+ D+I+Q+I+ C+ HG L Sbjct: 262 RLVEEECGSAPSEICSKKLNDLGFNYKYGLEDIIQQTINCCLDHGFL 308 >ref|XP_002282842.1| PREDICTED: dihydroflavonol-4-reductase-like [Vitis vinifera] Length = 354 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = -1 Query: 235 RSSEEQHKTIPSRISSKKLTDLGFEYKYGVGDVIKQSISSCMQHGLL 95 R EE+ + PS I SKKL DLGF YKYG+ D+I+Q+I+ C+ HG L Sbjct: 303 RLVEEECGSAPSEICSKKLNDLGFNYKYGLEDIIQQTINCCLDHGFL 349