BLASTX nr result
ID: Coptis23_contig00035387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035387 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32141.3| unnamed protein product [Vitis vinifera] 64 1e-08 >emb|CBI32141.3| unnamed protein product [Vitis vinifera] Length = 241 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/60 (56%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = -3 Query: 178 PKRRKLPQVQPSLRSRNKKRETVVLLDEEDCQLEETTQEEDEPVGRM-EAKLYYPSRDDP 2 PK+R QV PS SR +K +TVVLLDEE+ QL ET Q+ + RM E K+YYPSR+DP Sbjct: 153 PKKRSASQVLPSNDSRQRKGQTVVLLDEEEPQLIETNQQATKITERMKETKIYYPSREDP 212