BLASTX nr result
ID: Coptis23_contig00035301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035301 (463 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK49563.1| unknown [Lotus japonicus] 63 7e-11 ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207... 63 8e-11 ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like ... 63 2e-10 ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-3-like ... 63 2e-10 ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycin... 63 2e-10 >gb|AFK49563.1| unknown [Lotus japonicus] Length = 187 Score = 63.2 bits (152), Expect(2) = 7e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 122 DVYLKLLVKLYNFFVRRTGSNFNVVILKRLFVSKV 18 D+YLKLLVKLY F VRRTGSNFN VILKRLF+SKV Sbjct: 23 DIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKV 57 Score = 28.5 bits (62), Expect(2) = 7e-11 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 186 AGRKSKKTKRIAPK 145 AG KSKKTKRIAPK Sbjct: 7 AGGKSKKTKRIAPK 20 >ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207642 [Cucumis sativus] gi|449524956|ref|XP_004169487.1| PREDICTED: uncharacterized protein LOC101228164 [Cucumis sativus] Length = 389 Score = 63.2 bits (152), Expect(2) = 8e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 122 DVYLKLLVKLYNFFVRRTGSNFNVVILKRLFVSKV 18 D+YLKLLVKLY F VRRTGSNFN VILKRLF+SKV Sbjct: 225 DIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKV 259 Score = 28.1 bits (61), Expect(2) = 8e-11 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 186 AGRKSKKTKRIAPK 145 AG KSKKTKR+APK Sbjct: 209 AGGKSKKTKRVAPK 222 >ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus] gi|449490874|ref|XP_004158733.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus] Length = 187 Score = 63.2 bits (152), Expect(2) = 2e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 122 DVYLKLLVKLYNFFVRRTGSNFNVVILKRLFVSKV 18 D+YLKLLVKLY F VRRTGSNFN VILKRLF+SKV Sbjct: 23 DIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKV 57 Score = 26.6 bits (57), Expect(2) = 2e-10 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 186 AGRKSKKTKRIAPK 145 AG KSKKTKR APK Sbjct: 7 AGGKSKKTKRTAPK 20 >ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-3-like [Glycine max] Length = 187 Score = 63.2 bits (152), Expect(2) = 2e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 122 DVYLKLLVKLYNFFVRRTGSNFNVVILKRLFVSKV 18 D+YLKLLVKLY F VRRTGSNFN VILKRLF+SKV Sbjct: 23 DIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKV 57 Score = 26.6 bits (57), Expect(2) = 2e-10 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 186 AGRKSKKTKRIAPK 145 AG KSKKTKR APK Sbjct: 7 AGGKSKKTKRTAPK 20 >ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycine max] gi|255626631|gb|ACU13660.1| unknown [Glycine max] Length = 187 Score = 63.2 bits (152), Expect(2) = 2e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 122 DVYLKLLVKLYNFFVRRTGSNFNVVILKRLFVSKV 18 D+YLKLLVKLY F VRRTGSNFN VILKRLF+SKV Sbjct: 23 DIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKV 57 Score = 26.6 bits (57), Expect(2) = 2e-10 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 186 AGRKSKKTKRIAPK 145 AG KSKKTKR APK Sbjct: 7 AGGKSKKTKRTAPK 20