BLASTX nr result
ID: Coptis23_contig00035206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035206 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518046.1| ubiquitin-protein ligase, putative [Ricinus ... 74 1e-11 ref|XP_003621771.1| F-box family protein [Medicago truncatula] g... 71 8e-11 ref|XP_002300155.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 ref|XP_002516807.1| ubiquitin-protein ligase, putative [Ricinus ... 69 3e-10 ref|XP_002518045.1| ubiquitin-protein ligase, putative [Ricinus ... 69 5e-10 >ref|XP_002518046.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542642|gb|EEF44179.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 257 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/58 (55%), Positives = 45/58 (77%) Frame = -1 Query: 189 MSNLPEEMITSILSRLPVKPLLQFKSVCKSWYCLINDPIFIKMHLKHATRNNNLNAMY 16 MS LP+++IT ILSR+PVKPL++FK +CK+W LI++P F K+ LK A NNN++ Y Sbjct: 1 MSKLPQDLITEILSRVPVKPLIRFKCICKTWNSLISNPEFAKLQLKRAKENNNVSNHY 58 >ref|XP_003621771.1| F-box family protein [Medicago truncatula] gi|355496786|gb|AES77989.1| F-box family protein [Medicago truncatula] Length = 524 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -1 Query: 201 SFPRMSNLPEEMITSILSRLPVKPLLQFKSVCKSWYCLINDPIFIKMHLKHATRNNNLNA 22 + P LP+E++ ILSRLPV+ L+Q K VCKSW +I+DP FIKMHL + RN N + Sbjct: 87 NLPPSETLPDEVMAEILSRLPVRSLMQIKCVCKSWNTIISDPKFIKMHLNRSARNPNFSV 146 Query: 21 MYFD 10 + ++ Sbjct: 147 VSYE 150 >ref|XP_002300155.1| predicted protein [Populus trichocarpa] gi|222847413|gb|EEE84960.1| predicted protein [Populus trichocarpa] Length = 364 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -1 Query: 189 MSNLPEEMITSILSRLPVKPLLQFKSVCKSWYCLINDPIFIKMHLKHATRNNNLN 25 MS LP+++I IL+ LPVK L++FK VCK W LI+DP F+K+HLK A NN+N Sbjct: 1 MSKLPQDIIVDILTYLPVKSLVRFKCVCKPWQLLISDPRFVKLHLKRAIEGNNIN 55 >ref|XP_002516807.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223543895|gb|EEF45421.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 358 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = -1 Query: 189 MSNLPEEMITSILSRLPVKPLLQFKSVCKSWYCLINDPIFIKMHLKHATRNNNLN 25 M+NL ++++ IL RLPVK L +FK VCKSW+ LI+DP FI MHL AT+NN +N Sbjct: 1 MANLVQDVVLHILLRLPVKSLCRFKVVCKSWWLLISDPHFISMHLSLATKNNCIN 55 >ref|XP_002518045.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542641|gb|EEF44178.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 406 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = -1 Query: 189 MSNLPEEMITSILSRLPVKPLLQFKSVCKSWYCLINDPIFIKMHLKHATRNNNLN 25 +S LPE++I ILSR+PVKPLL+FK V KSW +I+DP F K+ LK A N+N++ Sbjct: 50 ISTLPEDLIVEILSRVPVKPLLRFKCVSKSWNSIISDPRFAKLQLKRAKENSNIS 104