BLASTX nr result
ID: Coptis23_contig00035062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035062 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608101.1| Mitogen-activated protein kinase [Medicago t... 73 3e-11 ref|XP_003564313.1| PREDICTED: mitogen-activated protein kinase ... 72 4e-11 gb|AAO16560.1| mitogen-activated protein kinase [Triticum aestivum] 72 5e-11 gb|ABM55743.1| mitogen-associated protein kinase 2 [Capsicum ann... 72 6e-11 gb|AAF81420.1| MAP kinase 2 [Capsicum annuum] 72 6e-11 >ref|XP_003608101.1| Mitogen-activated protein kinase [Medicago truncatula] gi|355509156|gb|AES90298.1| Mitogen-activated protein kinase [Medicago truncatula] Length = 279 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -1 Query: 415 LKSSEYSAAIDVRSVGCILMELMERKALFPRRDHVQQLRLLMEVNNL 275 L SS+Y+AAIDV SVGCI MELM+RK LFP RDHV QLRLLMEV +L Sbjct: 228 LNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMEVTSL 274 >ref|XP_003564313.1| PREDICTED: mitogen-activated protein kinase 1-like isoform 2 [Brachypodium distachyon] Length = 404 Score = 72.4 bits (176), Expect = 4e-11 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -1 Query: 415 LKSSEYSAAIDVRSVGCILMELMERKALFPRRDHVQQLRLLMEVNN 278 L SSEY+AAIDV SVGCI MELM+RK LFP RDHV QLRLLMEV + Sbjct: 233 LNSSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMEVRH 278 >gb|AAO16560.1| mitogen-activated protein kinase [Triticum aestivum] Length = 403 Score = 72.0 bits (175), Expect = 5e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = -1 Query: 415 LKSSEYSAAIDVRSVGCILMELMERKALFPRRDHVQQLRLLMEV 284 L SSEY+AAIDV SVGCI MELM+RK LFP RDHV QLRLLMEV Sbjct: 235 LNSSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMEV 278 >gb|ABM55743.1| mitogen-associated protein kinase 2 [Capsicum annuum] Length = 242 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 415 LKSSEYSAAIDVRSVGCILMELMERKALFPRRDHVQQLRLLMEV 284 L SS+Y+AAIDV SVGCI MELM+RK LFP RDHVQQLRLLME+ Sbjct: 120 LNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVQQLRLLMEL 163 >gb|AAF81420.1| MAP kinase 2 [Capsicum annuum] Length = 394 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 415 LKSSEYSAAIDVRSVGCILMELMERKALFPRRDHVQQLRLLMEV 284 L SS+Y+AAIDV SVGCI MELM+RK LFP RDHVQQLRLLME+ Sbjct: 234 LNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVQQLRLLMEL 277