BLASTX nr result
ID: Coptis23_contig00035015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00035015 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBK22033.2| unnamed protein product [Blastocystis hominis] 54 1e-05 >emb|CBK22033.2| unnamed protein product [Blastocystis hominis] Length = 476 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -3 Query: 306 EKYGKPVWIVPNSCGSTWGDEGFVYVKRGPNILGIEEGC 190 E+ G P WIV NS G+ WG+EGF + RG N LGIEEGC Sbjct: 144 EENGIPYWIVRNSWGTYWGEEGFFRIVRGKNNLGIEEGC 182