BLASTX nr result
ID: Coptis23_contig00034972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034972 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC63844.1| putative non-LTR retroelement reverse transcripta... 62 5e-08 emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis ... 60 1e-07 ref|XP_002519019.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 gb|AAD37021.1| putative non-LTR retrolelement reverse transcript... 57 2e-06 emb|CAB78008.1| putative protein [Arabidopsis thaliana] gi|73210... 55 8e-06 >gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1231 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -1 Query: 246 TEDSKSIHTVGWDIICKPKASGGLGLRKATDMNQAMLAKLSWKALTDKK 100 T + K H + W ICKPKA GG+GLR A DMN+A++AK+ W+ L DK+ Sbjct: 693 TMEKKKQHLLSWRKICKPKAEGGIGLRSARDMNKALVAKVGWRLLQDKE 741 >emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268307|emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 929 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/48 (50%), Positives = 35/48 (72%) Frame = -1 Query: 246 TEDSKSIHTVGWDIICKPKASGGLGLRKATDMNQAMLAKLSWKALTDK 103 T + + H + W +C+PKA+GGLGLR + DMN+A+LAK+ W+ L DK Sbjct: 628 TVEKRKQHLLSWKKVCRPKAAGGLGLRASKDMNRALLAKVGWRLLNDK 675 >ref|XP_002519019.1| conserved hypothetical protein [Ricinus communis] gi|223541682|gb|EEF43230.1| conserved hypothetical protein [Ricinus communis] Length = 148 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 228 IHTVGWDIICKPKASGGLGLRKATDMNQAMLAKLSWKALTDKK 100 +H + WD ICKPK+ GGLGLR+A D N ML KL WK L ++ Sbjct: 1 MHLLSWDKICKPKSRGGLGLREAVDFNTIMLMKLEWKYLLQQE 43 >gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 732 Score = 56.6 bits (135), Expect = 2e-06 Identities = 20/40 (50%), Positives = 31/40 (77%) Frame = -1 Query: 225 HTVGWDIICKPKASGGLGLRKATDMNQAMLAKLSWKALTD 106 H + W +CKP++ GGLG+RKA DMN+A+L+K+ W+ + D Sbjct: 362 HLISWKRVCKPRSEGGLGIRKAQDMNKALLSKVGWRLIQD 401 >emb|CAB78008.1| putative protein [Arabidopsis thaliana] gi|7321072|emb|CAB82119.1| putative protein [Arabidopsis thaliana] Length = 947 Score = 54.7 bits (130), Expect = 8e-06 Identities = 19/46 (41%), Positives = 33/46 (71%) Frame = -1 Query: 240 DSKSIHTVGWDIICKPKASGGLGLRKATDMNQAMLAKLSWKALTDK 103 + K +H V WD +C PK+ GGLG+R + MN+A+++K+ W+ + D+ Sbjct: 509 EKKKLHLVAWDRVCLPKSEGGLGIRTSKCMNKALVSKVGWRLINDR 554