BLASTX nr result
ID: Coptis23_contig00034859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034859 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275236.2| PREDICTED: pentatricopeptide repeat-containi... 140 1e-31 emb|CBI26570.3| unnamed protein product [Vitis vinifera] 140 1e-31 emb|CAN76112.1| hypothetical protein VITISV_005527 [Vitis vinifera] 140 1e-31 ref|XP_002519997.1| pentatricopeptide repeat-containing protein,... 139 2e-31 ref|XP_002309826.1| predicted protein [Populus trichocarpa] gi|2... 139 3e-31 >ref|XP_002275236.2| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Vitis vinifera] Length = 1442 Score = 140 bits (353), Expect = 1e-31 Identities = 67/87 (77%), Positives = 81/87 (93%) Frame = +1 Query: 1 RNGRFAKVQELLELMKSRGCEPDLVSFNTLINARAKSGTLLPGVAIKLLNEVRKSGLRPD 180 R GRF KVQELL+LM+SRGCEPDLVSFNTLINAR KSGT++ +AI+LLNEVR+SG++PD Sbjct: 234 RTGRFTKVQELLDLMRSRGCEPDLVSFNTLINARLKSGTMVTNLAIELLNEVRRSGIQPD 293 Query: 181 IITYNTLISACSRGSDLKEAVKIYDDL 261 IITYNTLISACSR S+L+EAVK+Y+D+ Sbjct: 294 IITYNTLISACSRESNLEEAVKVYNDM 320 >emb|CBI26570.3| unnamed protein product [Vitis vinifera] Length = 1042 Score = 140 bits (353), Expect = 1e-31 Identities = 67/87 (77%), Positives = 81/87 (93%) Frame = +1 Query: 1 RNGRFAKVQELLELMKSRGCEPDLVSFNTLINARAKSGTLLPGVAIKLLNEVRKSGLRPD 180 R GRF KVQELL+LM+SRGCEPDLVSFNTLINAR KSGT++ +AI+LLNEVR+SG++PD Sbjct: 209 RTGRFTKVQELLDLMRSRGCEPDLVSFNTLINARLKSGTMVTNLAIELLNEVRRSGIQPD 268 Query: 181 IITYNTLISACSRGSDLKEAVKIYDDL 261 IITYNTLISACSR S+L+EAVK+Y+D+ Sbjct: 269 IITYNTLISACSRESNLEEAVKVYNDM 295 >emb|CAN76112.1| hypothetical protein VITISV_005527 [Vitis vinifera] Length = 1494 Score = 140 bits (353), Expect = 1e-31 Identities = 67/87 (77%), Positives = 81/87 (93%) Frame = +1 Query: 1 RNGRFAKVQELLELMKSRGCEPDLVSFNTLINARAKSGTLLPGVAIKLLNEVRKSGLRPD 180 R GRF KVQELL+LM+SRGCEPDLVSFNTLINAR KSGT++ +AI+LLNEVR+SG++PD Sbjct: 266 RTGRFTKVQELLDLMRSRGCEPDLVSFNTLINARLKSGTMVTNLAIELLNEVRRSGIQPD 325 Query: 181 IITYNTLISACSRGSDLKEAVKIYDDL 261 IITYNTLISACSR S+L+EAVK+Y+D+ Sbjct: 326 IITYNTLISACSRESNLEEAVKVYNDM 352 >ref|XP_002519997.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540761|gb|EEF42321.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1429 Score = 139 bits (351), Expect = 2e-31 Identities = 67/88 (76%), Positives = 79/88 (89%) Frame = +1 Query: 1 RNGRFAKVQELLELMKSRGCEPDLVSFNTLINARAKSGTLLPGVAIKLLNEVRKSGLRPD 180 R GRF KVQ +L+LM+ RGCEPDLVSFNTLINAR K+G + P VAI+LLNEVR+SGLRPD Sbjct: 222 RTGRFNKVQGMLDLMRERGCEPDLVSFNTLINARLKAGAMTPNVAIELLNEVRRSGLRPD 281 Query: 181 IITYNTLISACSRGSDLKEAVKIYDDLE 264 IITYNTLISACSR S+L+EAVK++DD+E Sbjct: 282 IITYNTLISACSRESNLEEAVKVFDDME 309 >ref|XP_002309826.1| predicted protein [Populus trichocarpa] gi|222852729|gb|EEE90276.1| predicted protein [Populus trichocarpa] Length = 1480 Score = 139 bits (349), Expect = 3e-31 Identities = 65/88 (73%), Positives = 79/88 (89%) Frame = +1 Query: 1 RNGRFAKVQELLELMKSRGCEPDLVSFNTLINARAKSGTLLPGVAIKLLNEVRKSGLRPD 180 R GRF KVQELL+LM+ RGC+PDLVSFNTLINAR K+G ++P +AI+LLNEVR+SGLRPD Sbjct: 266 RRGRFNKVQELLDLMRERGCKPDLVSFNTLINARLKAGAMMPNLAIELLNEVRRSGLRPD 325 Query: 181 IITYNTLISACSRGSDLKEAVKIYDDLE 264 ITYNTLISACSR S+L+EA K++DD+E Sbjct: 326 TITYNTLISACSRASNLEEAAKVFDDME 353