BLASTX nr result
ID: Coptis23_contig00034666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034666 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531408.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002531408.1| conserved hypothetical protein [Ricinus communis] gi|223529001|gb|EEF30992.1| conserved hypothetical protein [Ricinus communis] Length = 162 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = +2 Query: 209 KAISSNTLLLNATSTQCKYVYPDPVPEFAQTESLKFRSELRKKLWTNKE-FGDDL 370 K ISSNT+ AT + YVY DP+PEFAQ+E+ KFR+E+ KKL +K+ FG DL Sbjct: 37 KPISSNTV--GATPSFQNYVYSDPIPEFAQSETEKFRAEILKKLSKDKQTFGGDL 89