BLASTX nr result
ID: Coptis23_contig00034637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034637 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003560092.1| PREDICTED: B3 domain-containing protein Os07... 56 3e-06 ref|XP_002967591.1| hypothetical protein SELMODRAFT_451626 [Sela... 56 3e-06 ref|XP_002981754.1| hypothetical protein SELMODRAFT_451631 [Sela... 56 3e-06 ref|XP_002521436.1| transcription factor, putative [Ricinus comm... 55 6e-06 ref|XP_002537641.1| hypothetical protein RCOM_1933560 [Ricinus c... 55 6e-06 >ref|XP_003560092.1| PREDICTED: B3 domain-containing protein Os07g0563300-like [Brachypodium distachyon] Length = 989 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -2 Query: 282 TCIVCIQSPTGKGLKHKETCICNVCSIVSRRRLTFEELCRGQRVS*EET 136 +CIVCIQ P+GKG KHK+TC CNVC V RRR L R +R+S ++T Sbjct: 858 SCIVCIQPPSGKGPKHKQTCTCNVCMTV-RRRFKTLMLRREKRLSEKDT 905 >ref|XP_002967591.1| hypothetical protein SELMODRAFT_451626 [Selaginella moellendorffii] gi|300164329|gb|EFJ30938.1| hypothetical protein SELMODRAFT_451626 [Selaginella moellendorffii] Length = 872 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -2 Query: 282 TCIVCIQSPTGKGLKHKETCICNVCSIVSRR 190 TCIVCIQ P+GKG KHK TC+CNVC V RR Sbjct: 613 TCIVCIQPPSGKGPKHKPTCVCNVCLTVKRR 643 >ref|XP_002981754.1| hypothetical protein SELMODRAFT_451631 [Selaginella moellendorffii] gi|300150586|gb|EFJ17236.1| hypothetical protein SELMODRAFT_451631 [Selaginella moellendorffii] Length = 855 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -2 Query: 282 TCIVCIQSPTGKGLKHKETCICNVCSIVSRR 190 TCIVCIQ P+GKG KHK TC+CNVC V RR Sbjct: 613 TCIVCIQPPSGKGPKHKPTCVCNVCLTVKRR 643 >ref|XP_002521436.1| transcription factor, putative [Ricinus communis] gi|223539335|gb|EEF40926.1| transcription factor, putative [Ricinus communis] Length = 854 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -2 Query: 282 TCIVCIQSPTGKGLKHKETCICNVCSIVSRR 190 +CIVCIQ P+GKG KHK+TC CNVC V RR Sbjct: 653 SCIVCIQPPSGKGPKHKQTCTCNVCQTVKRR 683 >ref|XP_002537641.1| hypothetical protein RCOM_1933560 [Ricinus communis] gi|223515648|gb|EEF24742.1| hypothetical protein RCOM_1933560 [Ricinus communis] Length = 185 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -2 Query: 282 TCIVCIQSPTGKGLKHKETCICNVCSIVSRR 190 +CIVCIQ P+GKG KHK+TC CNVC V RR Sbjct: 65 SCIVCIQPPSGKGPKHKQTCTCNVCQTVKRR 95