BLASTX nr result
ID: Coptis23_contig00034529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034529 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170204.1| PREDICTED: probable LRR receptor-like serine... 55 5e-06 >ref|XP_004170204.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Length = 751 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 148 FPILLICIALQ-LSLSTAAILGNETDKLALIAFKSEIILDPYNITASWND 2 F ++L+C L L L +AA+ GNETD+LAL++FKSEI +DP+ + SWN+ Sbjct: 15 FELILMCFLLFILPLPSAALEGNETDRLALLSFKSEITVDPFGLFISWNE 64