BLASTX nr result
ID: Coptis23_contig00034450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034450 (554 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268575.1| PREDICTED: signal peptide peptidase-like 2B ... 62 5e-08 emb|CAN80806.1| hypothetical protein VITISV_023748 [Vitis vinifera] 61 1e-07 ref|XP_004160230.1| PREDICTED: signal peptide peptidase-like 2-l... 58 1e-06 ref|XP_004138358.1| PREDICTED: signal peptide peptidase-like 5-l... 58 1e-06 emb|CBI35429.3| unnamed protein product [Vitis vinifera] 58 1e-06 >ref|XP_002268575.1| PREDICTED: signal peptide peptidase-like 2B [Vitis vinifera] gi|296089635|emb|CBI39454.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +1 Query: 1 EDLYKMVCPENDTSLDIRIPVVMIPKSGGEAIKKAMLAGKKSE 129 ED+YKMVC ENDT ++I IPVVMIPKSGG+ + K++ GKK E Sbjct: 135 EDIYKMVCSENDTIVNITIPVVMIPKSGGDTLSKSIADGKKVE 177 >emb|CAN80806.1| hypothetical protein VITISV_023748 [Vitis vinifera] Length = 531 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 1 EDLYKMVCPENDTSLDIRIPVVMIPKSGGEAIKKAMLAGKK 123 ED+YKMVC ENDT ++I IPVVMIPKSGG+ + K++ GKK Sbjct: 290 EDIYKMVCSENDTIVNITIPVVMIPKSGGDTLSKSIADGKK 330 >ref|XP_004160230.1| PREDICTED: signal peptide peptidase-like 2-like [Cucumis sativus] Length = 435 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 1 EDLYKMVCPENDTSLDIRIPVVMIPKSGGEAIKKAMLAGK 120 EDLYKMVC E DT+L+I IPVVM+PKS G+A+ K + GK Sbjct: 144 EDLYKMVCSEKDTALNISIPVVMLPKSSGDALSKLITDGK 183 >ref|XP_004138358.1| PREDICTED: signal peptide peptidase-like 5-like [Cucumis sativus] Length = 541 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 1 EDLYKMVCPENDTSLDIRIPVVMIPKSGGEAIKKAMLAGK 120 EDLYKMVC E DT+L+I IPVVM+PKS G+A+ K + GK Sbjct: 144 EDLYKMVCSEKDTALNISIPVVMLPKSSGDALSKLITDGK 183 >emb|CBI35429.3| unnamed protein product [Vitis vinifera] Length = 220 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +1 Query: 1 EDLYKMVCPENDTSLDIRIPVVMIPKSGGEAIKKAMLAGKKSEPFHSHYSFCVSIVI 171 ED+YKMVC EN T ++I IPVV+IPK GG + K + GKK E +Y V I I Sbjct: 73 EDIYKMVCSENVTIVNITIPVVLIPKLGGVTLNKCIADGKKGESLSINYKGLVVICI 129