BLASTX nr result
ID: Coptis23_contig00034389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034389 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519098.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 ref|XP_002281077.1| PREDICTED: cytochrome c biogenesis protein C... 55 5e-06 >ref|XP_002519098.1| conserved hypothetical protein [Ricinus communis] gi|223541761|gb|EEF43309.1| conserved hypothetical protein [Ricinus communis] Length = 556 Score = 55.5 bits (132), Expect = 5e-06 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 8/78 (10%) Frame = +3 Query: 150 SKRVPSLKIVFELKMNK------KNVPKKIILSEGAPKLPED--VGNNDDVQPKLISSDG 305 ++R SL + +LK +K KNV +KI+LS AP + E+ GNN ++ P + G Sbjct: 38 NRRALSLSVSCKLKTSKEVENKDKNVSRKILLSNSAPPVSEEGGAGNNGEI-PDKAAKGG 96 Query: 306 GGVLRFVKRVPRRALSIL 359 GG LRF KR+PR+ LS+L Sbjct: 97 GGPLRFFKRLPRKVLSVL 114 >ref|XP_002281077.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic [Vitis vinifera] gi|297741415|emb|CBI32546.3| unnamed protein product [Vitis vinifera] Length = 557 Score = 55.5 bits (132), Expect = 5e-06 Identities = 45/116 (38%), Positives = 57/116 (49%), Gaps = 17/116 (14%) Frame = +3 Query: 63 MHSLNPSRTLNHVTPQPLL---FKPHRHNNYTSKRVP------SLKIVFELKMNK----- 200 M++L PS + PLL FKP T P S I +LK ++ Sbjct: 1 MYTLKPSFSKTLFLKSPLLRSSFKPQFFPYTTQISSPCSSTPLSFSITCKLKTSEDGKSS 60 Query: 201 KNVPKKIILSEGAPKLPEDVGNNDDVQPKLISSDGGGVLRF---VKRVPRRALSIL 359 K++ KKI+LSEGAP + ED N + QPK S GGG F VKR PR+ LS L Sbjct: 61 KSLAKKIVLSEGAPAVSEDGAGNGEAQPKPASKGGGGGGGFGGLVKRFPRKVLSRL 116