BLASTX nr result
ID: Coptis23_contig00034349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034349 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003557546.1| PREDICTED: 40S ribosomal protein S18-like [B... 67 1e-09 ref|XP_003557516.1| PREDICTED: 40S ribosomal protein S18-like [B... 67 1e-09 pdb|3IZ6|M Chain M, Localization Of The Small Subunit Ribosomal ... 67 1e-09 ref|XP_004140957.1| PREDICTED: 40S ribosomal protein S18-like [C... 66 3e-09 ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [C... 66 3e-09 >ref|XP_003557546.1| PREDICTED: 40S ribosomal protein S18-like [Brachypodium distachyon] Length = 152 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 1 HRGLRHYWGVWVHGQHTKTTSRRGKTVGVSKKR 99 HRGLRHYWGV V GQHTKTT RRGKTVGVSKKR Sbjct: 120 HRGLRHYWGVRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_003557516.1| PREDICTED: 40S ribosomal protein S18-like [Brachypodium distachyon] Length = 152 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 1 HRGLRHYWGVWVHGQHTKTTSRRGKTVGVSKKR 99 HRGLRHYWGV V GQHTKTT RRGKTVGVSKKR Sbjct: 120 HRGLRHYWGVRVRGQHTKTTGRRGKTVGVSKKR 152 >pdb|3IZ6|M Chain M, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome gi|22204120|gb|AAM92708.1| putative ribosomal protein S18 [Triticum aestivum] Length = 152 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 1 HRGLRHYWGVWVHGQHTKTTSRRGKTVGVSKKR 99 HRGLRHYWGV V GQHTKTT RRGKTVGVSKKR Sbjct: 120 HRGLRHYWGVRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_004140957.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] Length = 137 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 HRGLRHYWGVWVHGQHTKTTSRRGKTVGVSKKR 99 HRGLRHYWG+ V GQHTKTT RRGKTVGVSKKR Sbjct: 105 HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 137 >ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] gi|449525091|ref|XP_004169553.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] Length = 152 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 HRGLRHYWGVWVHGQHTKTTSRRGKTVGVSKKR 99 HRGLRHYWG+ V GQHTKTT RRGKTVGVSKKR Sbjct: 120 HRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152