BLASTX nr result
ID: Coptis23_contig00034147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034147 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9S9V9.1|FBL23_ARATH RecName: Full=Putative F-box/LRR-repeat ... 55 6e-06 >sp|Q9S9V9.1|FBL23_ARATH RecName: Full=Putative F-box/LRR-repeat protein 23 gi|5732066|gb|AAD48965.1|AF147263_7 contains similarity to Medicago truncatula N7 protein (GB:Y17613) [Arabidopsis thaliana] gi|7267310|emb|CAB81092.1| AT4g05500 [Arabidopsis thaliana] Length = 449 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 21 LTDSGLQAALDGCPQLKYIVLRNCFNINLGGNLLKRCVLR 140 LT+ GL A LDGCP L+++ LR CFNINL G+L KRC R Sbjct: 372 LTNKGLNAILDGCPHLEHLDLRQCFNINLVGDLKKRCFER 411