BLASTX nr result
ID: Coptis23_contig00033354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00033354 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69116.1| hypothetical protein VITISV_031843 [Vitis vinifera] 61 8e-08 ref|XP_002284795.1| PREDICTED: F-box protein SKIP23-like [Vitis ... 60 2e-07 ref|XP_002528337.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002528428.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus ... 58 7e-07 >emb|CAN69116.1| hypothetical protein VITISV_031843 [Vitis vinifera] Length = 389 Score = 61.2 bits (147), Expect = 8e-08 Identities = 37/97 (38%), Positives = 56/97 (57%), Gaps = 4/97 (4%) Frame = -2 Query: 283 PKVSVI-LPKQKRGGVV*LVKASIS*YHLGTYCKFRGGGKRDES---HHTYRFEVFKLDT 116 P+VS+I +P+Q G + LV++ + Y + D++ + T RF+V +LD+ Sbjct: 238 PRVSIIEMPQQFGGDLQYLVESGEELLLVTRYLDLTYDVEXDQTSLIYRTTRFQVCRLDS 297 Query: 115 TQAEWVEVKNLGGHVLFLGQNTSMSLSASDFPGCKLN 5 W V +LG LFLG+N S+SLS+ DFPGCK N Sbjct: 298 KAPRWEVVSSLGDRALFLGENLSLSLSSVDFPGCKGN 334 >ref|XP_002284795.1| PREDICTED: F-box protein SKIP23-like [Vitis vinifera] Length = 389 Score = 60.1 bits (144), Expect = 2e-07 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 4/97 (4%) Frame = -2 Query: 283 PKVSVI-LPKQKRGGVV*LVKASIS*YHLGTYCKFRGGGKRDES---HHTYRFEVFKLDT 116 P+VS+I +P+Q G + LV++ + Y + D++ + T RF+V +LD Sbjct: 238 PRVSIIEMPQQFGGDLQYLVESGEELLLVTRYLDLTYDVEPDQTSLIYRTTRFQVCRLDL 297 Query: 115 TQAEWVEVKNLGGHVLFLGQNTSMSLSASDFPGCKLN 5 W V +LG LFLG+N S+SLS+ DFPGCK N Sbjct: 298 KAPRWEVVSSLGDRALFLGENLSLSLSSVDFPGCKGN 334 >ref|XP_002528337.1| conserved hypothetical protein [Ricinus communis] gi|223532205|gb|EEF34009.1| conserved hypothetical protein [Ricinus communis] Length = 102 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -2 Query: 139 FEVFKLDTTQAEWVEVKNLGGHVLFLGQNTSMSLSASDFPGCKLNS 2 F V++LD+++ WVEV++L VLFLG N SMSLSA DF GC NS Sbjct: 2 FHVYRLDSSEQNWVEVESLNNQVLFLGMNHSMSLSAQDFSGCDRNS 47 >ref|XP_002528428.1| conserved hypothetical protein [Ricinus communis] gi|223532164|gb|EEF33970.1| conserved hypothetical protein [Ricinus communis] Length = 339 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -2 Query: 157 SHHTYRFEVFKLDTTQAEWVEVKNLGGHVLFLGQNTSMSLSASDFPGCKLN 5 S T RF+VFKLD W+EVK+LG VLFLG +++ S S SD GCK N Sbjct: 224 SERTVRFKVFKLDKEAQTWIEVKSLGDRVLFLGDDSTFSASVSDLSGCKGN 274 >ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223551319|gb|EEF52805.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 398 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -2 Query: 154 HHTYRFEVFKLDTTQAEWVEVKNLGGHVLFLGQNTSMSLSASDFPGCKLN 5 + T RFEVF+LD +W+ + LG LF+G+N+S+SLSA+DF GC N Sbjct: 290 YRTIRFEVFRLDWNGPQWLRMSTLGDKALFIGENSSLSLSATDFSGCMGN 339