BLASTX nr result
ID: Coptis23_contig00033339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00033339 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315805.1| predicted protein [Populus trichocarpa] gi|2... 54 9e-11 ref|XP_004142331.1| PREDICTED: putative potassium transporter 12... 54 2e-09 ref|XP_004156141.1| PREDICTED: LOW QUALITY PROTEIN: putative pot... 54 2e-09 ref|XP_002534326.1| Potassium transporter, putative [Ricinus com... 55 2e-09 ref|XP_002311590.1| predicted protein [Populus trichocarpa] gi|2... 54 6e-09 >ref|XP_002315805.1| predicted protein [Populus trichocarpa] gi|222864845|gb|EEF01976.1| predicted protein [Populus trichocarpa] Length = 847 Score = 54.3 bits (129), Expect(3) = 9e-11 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 135 QIAFTFVVFPCLLLAYTGQASYLVKYPSAA 224 QIAFT VVFPCLLLAY GQASYL+KYP +A Sbjct: 375 QIAFTCVVFPCLLLAYMGQASYLMKYPDSA 404 Score = 32.7 bits (73), Expect(3) = 9e-11 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +1 Query: 1 AMFADLGHFSVKSIKASF 54 AMFADLGHFSV+SI+ +F Sbjct: 361 AMFADLGHFSVQSIQIAF 378 Score = 23.5 bits (49), Expect(3) = 9e-11 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +2 Query: 224 DSANRVFYASVP 259 DSA+R+FY SVP Sbjct: 402 DSASRIFYDSVP 413 >ref|XP_004142331.1| PREDICTED: putative potassium transporter 12-like [Cucumis sativus] Length = 911 Score = 54.3 bits (129), Expect(3) = 2e-09 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 135 QIAFTFVVFPCLLLAYTGQASYLVKYPSAA 224 QIAFTFVVFPCLLLAY GQA+YL+K+P +A Sbjct: 441 QIAFTFVVFPCLLLAYMGQAAYLMKHPDSA 470 Score = 29.6 bits (65), Expect(3) = 2e-09 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +1 Query: 1 AMFADLGHFSVKSIKASF 54 AMFADLGHF+V +I+ +F Sbjct: 427 AMFADLGHFTVPAIQIAF 444 Score = 22.3 bits (46), Expect(3) = 2e-09 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 224 DSANRVFYASVP 259 DSA R+FY SVP Sbjct: 468 DSAARIFYDSVP 479 >ref|XP_004156141.1| PREDICTED: LOW QUALITY PROTEIN: putative potassium transporter 12-like [Cucumis sativus] Length = 838 Score = 54.3 bits (129), Expect(3) = 2e-09 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 135 QIAFTFVVFPCLLLAYTGQASYLVKYPSAA 224 QIAFTFVVFPCLLLAY GQA+YL+K+P +A Sbjct: 368 QIAFTFVVFPCLLLAYMGQAAYLMKHPDSA 397 Score = 29.6 bits (65), Expect(3) = 2e-09 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +1 Query: 1 AMFADLGHFSVKSIKASF 54 AMFADLGHF+V +I+ +F Sbjct: 354 AMFADLGHFTVPAIQIAF 371 Score = 22.3 bits (46), Expect(3) = 2e-09 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 224 DSANRVFYASVP 259 DSA R+FY SVP Sbjct: 395 DSAARIFYDSVP 406 >ref|XP_002534326.1| Potassium transporter, putative [Ricinus communis] gi|223525500|gb|EEF28062.1| Potassium transporter, putative [Ricinus communis] Length = 957 Score = 54.7 bits (130), Expect(2) = 2e-09 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 135 QIAFTFVVFPCLLLAYTGQASYLVKYPSAA 224 QIAF+FVVFPCLLLAY GQASYL+KYP ++ Sbjct: 372 QIAFSFVVFPCLLLAYMGQASYLMKYPQSS 401 Score = 32.0 bits (71), Expect(2) = 2e-09 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = +1 Query: 1 AMFADLGHFSVKSIKASF 54 AMFADLGHF+VK+I+ +F Sbjct: 358 AMFADLGHFNVKAIQIAF 375 >ref|XP_002311590.1| predicted protein [Populus trichocarpa] gi|222851410|gb|EEE88957.1| predicted protein [Populus trichocarpa] Length = 818 Score = 54.3 bits (129), Expect(2) = 6e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 135 QIAFTFVVFPCLLLAYTGQASYLVKYPSAA 224 QIAFT VVFPCLLLAY GQASYL+KYP +A Sbjct: 357 QIAFTCVVFPCLLLAYMGQASYLMKYPDSA 386 Score = 30.8 bits (68), Expect(2) = 6e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 1 AMFADLGHFSVKSIKASF 54 AMFADLGHF V+SI+ +F Sbjct: 343 AMFADLGHFCVESIQIAF 360