BLASTX nr result
ID: Coptis23_contig00033150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00033150 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19301.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_002283694.2| PREDICTED: MADS-box transcription factor 27 ... 55 5e-06 >emb|CBI19301.3| unnamed protein product [Vitis vinifera] Length = 240 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +1 Query: 1 SVSEDLHFPIHLQLSQPEQQNYE-SPTRAAKLGRLQLQ 111 S+ EDLH PIHLQL QP+QQNYE +P RA KLGRLQLQ Sbjct: 203 SIGEDLHVPIHLQLCQPQQQNYETTPARATKLGRLQLQ 240 >ref|XP_002283694.2| PREDICTED: MADS-box transcription factor 27 [Vitis vinifera] Length = 320 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = +1 Query: 1 SVSEDLHFPIHLQLSQPEQQNYE-SPTRAAKLGRLQL 108 S+ EDLH PIHLQL QP+QQNYE +P RA KLGR Q+ Sbjct: 203 SIGEDLHVPIHLQLCQPQQQNYETTPARATKLGRCQV 239