BLASTX nr result
ID: Coptis23_contig00033090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00033090 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC53892.1| cytochrome P450 [Petunia x hybrida] 60 2e-07 ref|XP_002332630.1| cytochrome P450 [Populus trichocarpa] gi|222... 60 3e-07 ref|XP_002332631.1| cytochrome P450 [Populus trichocarpa] gi|222... 59 5e-07 ref|XP_003535793.1| PREDICTED: cytochrome P450 76A2-like [Glycin... 58 8e-07 ref|XP_003631494.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 57 1e-06 >dbj|BAC53892.1| cytochrome P450 [Petunia x hybrida] Length = 510 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -3 Query: 282 LAELLHNPGVMKKVMVELDEIVDPNKKIEECDVENLHFLQAVVKET 145 LAELL NP M +V E++E+V N+K EE D++NLH++QAVVKET Sbjct: 319 LAELLCNPEAMTRVKAEINEVVGSNRKFEESDIDNLHYMQAVVKET 364 >ref|XP_002332630.1| cytochrome P450 [Populus trichocarpa] gi|222832857|gb|EEE71334.1| cytochrome P450 [Populus trichocarpa] Length = 516 Score = 59.7 bits (143), Expect = 3e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -3 Query: 282 LAELLHNPGVMKKVMVELDEIVDPNKKIEECDVENLHFLQAVVKET 145 +AELLHNP VMK V EL + PNKK+E+ D+ENL +L+AV++ET Sbjct: 323 MAELLHNPKVMKTVQSELRSTIGPNKKLEDKDIENLPYLKAVIRET 368 >ref|XP_002332631.1| cytochrome P450 [Populus trichocarpa] gi|222832858|gb|EEE71335.1| cytochrome P450 [Populus trichocarpa] Length = 516 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -3 Query: 282 LAELLHNPGVMKKVMVELDEIVDPNKKIEECDVENLHFLQAVVKET 145 +AELLHNP V+K V EL + PNKK+E+ DVENL +L+AV++ET Sbjct: 323 MAELLHNPKVLKTVQSELRSTIGPNKKLEDKDVENLPYLKAVIRET 368 >ref|XP_003535793.1| PREDICTED: cytochrome P450 76A2-like [Glycine max] Length = 510 Score = 58.2 bits (139), Expect = 8e-07 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = -3 Query: 282 LAELLHNPGVMKKVMVELDEIVDPNKKIEECDVENLHFLQAVVKET 145 +AELLHNP +KKV +EL + P++ +EE D+ENL +LQAV+KET Sbjct: 319 MAELLHNPKALKKVQMELRSKIGPDRNMEEKDIENLPYLQAVIKET 364 >ref|XP_003631494.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76C4-like [Vitis vinifera] Length = 480 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = -3 Query: 282 LAELLHNPGVMKKVMVELDEIVDPNKKIEECDVENLHFLQAVVKETNEDFTVLSLHL 112 + ELL NP VM+KV +EL EI+ P ++I+E D++ L + QAVVKET F L+ HL Sbjct: 292 MVELLRNPHVMQKVRIELSEIISPTRRIKESDIDXLPYFQAVVKETMR-FHPLAPHL 347