BLASTX nr result
ID: Coptis23_contig00032307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00032307 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005097866.1| RNA polymerase beta subunit (chloroplast) [C... 105 5e-21 ref|YP_002836082.1| RNA polymerase beta subunit [Megaleranthis s... 105 5e-21 gb|AFB18329.1| RNA polymerase beta subunit [Molineria capitulata] 104 7e-21 ref|YP_001004178.1| RNA polymerase beta subunit [Ranunculus macr... 104 9e-21 ref|YP_004563859.1| RNA polymerase beta subunit [Nelumbo lutea] ... 103 1e-20 >ref|YP_005097866.1| RNA polymerase beta subunit (chloroplast) [Colocasia esculenta] gi|340536631|gb|AEK48398.1| RNA polymerase beta subunit (chloroplast) [Colocasia esculenta] gi|340536718|gb|AEK48484.1| RNA polymerase beta subunit (chloroplast) [Colocasia esculenta] Length = 1072 Score = 105 bits (261), Expect = 5e-21 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = +3 Query: 3 QEVLGTTIVGGTISNPEDAPESFRLLVQELRSLALELNHFLVSEKNFQINRKEA 164 QEVLGTTI+GGTISNPEDAPESFRLLV+ELRSLALELNHFLVSEKNFQINRKEA Sbjct: 1019 QEVLGTTIIGGTISNPEDAPESFRLLVRELRSLALELNHFLVSEKNFQINRKEA 1072 >ref|YP_002836082.1| RNA polymerase beta subunit [Megaleranthis saniculifolia] gi|226933874|gb|ACO92007.1| RNA polymerase beta subunit [Megaleranthis saniculifolia] Length = 1071 Score = 105 bits (261), Expect = 5e-21 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = +3 Query: 3 QEVLGTTIVGGTISNPEDAPESFRLLVQELRSLALELNHFLVSEKNFQINRKEA 164 QEVLGTTI+GGTISNPEDAPESFRLLV+ELRSLALELNHFLVSEKNFQINRKEA Sbjct: 1018 QEVLGTTIIGGTISNPEDAPESFRLLVRELRSLALELNHFLVSEKNFQINRKEA 1071 >gb|AFB18329.1| RNA polymerase beta subunit [Molineria capitulata] Length = 1070 Score = 104 bits (260), Expect = 7e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = +3 Query: 3 QEVLGTTIVGGTISNPEDAPESFRLLVQELRSLALELNHFLVSEKNFQINRKEA 164 QEVLGTTI+GGT+SNPEDAPESFRLLV+ELRSLALELNHFLVSEKNFQINRKEA Sbjct: 1017 QEVLGTTIIGGTVSNPEDAPESFRLLVRELRSLALELNHFLVSEKNFQINRKEA 1070 >ref|YP_001004178.1| RNA polymerase beta subunit [Ranunculus macranthus] gi|69216920|gb|AAZ03994.1| RNA polymerase beta chain [Ranunculus macranthus] gi|85540796|gb|ABC70748.1| RNA polymerase beta subunit [Ranunculus macranthus] Length = 1070 Score = 104 bits (259), Expect = 9e-21 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = +3 Query: 3 QEVLGTTIVGGTISNPEDAPESFRLLVQELRSLALELNHFLVSEKNFQINRKEA 164 QEVLGTTI+GGTISNPEDAPESFRLLV+ELRSLALELNHFLVSEKNFQINRKEA Sbjct: 1017 QEVLGTTIMGGTISNPEDAPESFRLLVRELRSLALELNHFLVSEKNFQINRKEA 1070 >ref|YP_004563859.1| RNA polymerase beta subunit [Nelumbo lutea] gi|224474126|gb|ACN49315.1| RNA polymerase beta subunit [Nelumbo lutea] gi|383286884|gb|AFH01533.1| RNA polymerase beta subunit (chloroplast) [Nelumbo lutea] Length = 1070 Score = 103 bits (258), Expect = 1e-20 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = +3 Query: 3 QEVLGTTIVGGTISNPEDAPESFRLLVQELRSLALELNHFLVSEKNFQINRKEA 164 QEVLGTTI+GGTI+NPEDAPESFRLLV+ELRSLALELNHFLVSEKNFQINRKEA Sbjct: 1017 QEVLGTTIIGGTITNPEDAPESFRLLVRELRSLALELNHFLVSEKNFQINRKEA 1070