BLASTX nr result
ID: Coptis23_contig00032296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00032296 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI34306.1| Polyprotein, putative [Solanum demissum] 39 6e-06 >gb|ABI34306.1| Polyprotein, putative [Solanum demissum] Length = 1691 Score = 39.3 bits (90), Expect(2) = 6e-06 Identities = 23/51 (45%), Positives = 30/51 (58%) Frame = -3 Query: 173 FYLMYPWHRLVQATLIHC*SAATTGRVCSKCTNGKSIQICRKHTTVRIFPT 21 F L Y + + + LIHC S A GRV ++ NGKS I RKH+ VR + T Sbjct: 1169 FQLPY-FEKPIPPILIHCNSTAAIGRVQNRYYNGKSRPIRRKHSNVRSYLT 1218 Score = 35.4 bits (80), Expect(2) = 6e-06 Identities = 15/25 (60%), Positives = 22/25 (88%) Frame = -2 Query: 231 KSELIALAAVSEEASWMRNLLSDVP 157 ++ELIALA+ SEEA+W+R+LL +P Sbjct: 1148 EAELIALASASEEANWLRDLLFQLP 1172