BLASTX nr result
ID: Coptis23_contig00032218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00032218 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166514.1| PREDICTED: LOW QUALITY PROTEIN: conserved ol... 89 4e-16 ref|XP_004140637.1| PREDICTED: conserved oligomeric Golgi comple... 89 4e-16 ref|XP_003626606.1| Conserved oligomeric Golgi complex subunit [... 89 4e-16 ref|XP_002302674.1| predicted protein [Populus trichocarpa] gi|2... 89 4e-16 ref|XP_002267721.2| PREDICTED: conserved oligomeric Golgi comple... 89 5e-16 >ref|XP_004166514.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex subunit 4-like [Cucumis sativus] Length = 751 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 217 SELLDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALRL 89 SE+LDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAAL+L Sbjct: 709 SEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 751 >ref|XP_004140637.1| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Cucumis sativus] Length = 751 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 217 SELLDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALRL 89 SE+LDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAAL+L Sbjct: 709 SEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 751 >ref|XP_003626606.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula] gi|87240849|gb|ABD32707.1| Conserved oligomeric Golgi complex component 4, related [Medicago truncatula] gi|355501621|gb|AES82824.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula] Length = 747 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 217 SELLDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALRL 89 SE+LDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAAL+L Sbjct: 705 SEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 747 >ref|XP_002302674.1| predicted protein [Populus trichocarpa] gi|222844400|gb|EEE81947.1| predicted protein [Populus trichocarpa] Length = 177 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 217 SELLDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALRL 89 SE+LDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAAL+L Sbjct: 135 SEILDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALKL 177 >ref|XP_002267721.2| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Vitis vinifera] Length = 1105 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 217 SELLDFWGENSGPMTWRLTPAEVRRVLGLRVDFKPEAIAALRL 89 SE+LDFWGENSGPMTWRLTPAEVRRVLGLR+DFKPEAIAAL+L Sbjct: 1063 SEILDFWGENSGPMTWRLTPAEVRRVLGLRIDFKPEAIAALKL 1105