BLASTX nr result
ID: Coptis23_contig00032058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00032058 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521029.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] 58 9e-07 ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago ... 55 5e-06 >ref|XP_002521029.1| conserved hypothetical protein [Ricinus communis] gi|223539866|gb|EEF41446.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = -2 Query: 209 LQRIVPGGHGLEPDRLFLQTANYILHLKLQVNMLQALSMMY 87 LQR++PGG L+PDRLFL+TA+YILHL+LQVN+LQALS +Y Sbjct: 46 LQRLIPGGEELQPDRLFLRTADYILHLELQVNVLQALSEIY 86 >emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] Length = 77 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/41 (63%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = -2 Query: 209 LQRIVPGGHGLEPDRLFLQTANYILHLKLQVN-MLQALSMM 90 LQR++PGG GL+PDRLFL+TA+YILHL+LQ+ +L A++M+ Sbjct: 29 LQRLIPGGRGLQPDRLFLRTADYILHLRLQMGILLYAVTML 69 >ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|357516789|ref|XP_003628683.1| hypothetical protein MTR_8g063410 [Medicago truncatula] gi|355478488|gb|AES59691.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|355522705|gb|AET03159.1| hypothetical protein MTR_8g063410 [Medicago truncatula] Length = 72 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -2 Query: 209 LQRIVPGGHGLEPDRLFLQTANYILHLKLQVNMLQALSMMY 87 LQRI+PGG GL+ D+LFL+TA +IL L+LQ+N LQAL+ ++ Sbjct: 30 LQRIIPGGDGLKADQLFLRTAEHILQLRLQLNALQALTKIF 70