BLASTX nr result
ID: Coptis23_contig00031188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00031188 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535003.1| conserved hypothetical protein [Ricinus comm... 69 5e-10 ref|XP_002539514.1| conserved hypothetical protein [Ricinus comm... 69 5e-10 ref|XP_002540127.1| conserved hypothetical protein [Ricinus comm... 69 5e-10 >ref|XP_002535003.1| conserved hypothetical protein [Ricinus communis] gi|223524217|gb|EEF27385.1| conserved hypothetical protein [Ricinus communis] Length = 81 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 235 AGCRPRWSWEPTYTFLGLAFPQHRNKERALKRNQP 131 AGCRPRWSWEPTYTFLGLA PQH K RA KR QP Sbjct: 28 AGCRPRWSWEPTYTFLGLALPQHLKKRRAPKRKQP 62 >ref|XP_002539514.1| conserved hypothetical protein [Ricinus communis] gi|223505440|gb|EEF22868.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 235 AGCRPRWSWEPTYTFLGLAFPQHRNKERALKRNQP 131 AGCRPRWSWEPTYTFLGLA PQH K RA KR QP Sbjct: 71 AGCRPRWSWEPTYTFLGLALPQHLKKRRAPKRKQP 105 >ref|XP_002540127.1| conserved hypothetical protein [Ricinus communis] gi|223498957|gb|EEF22255.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 235 AGCRPRWSWEPTYTFLGLAFPQHRNKERALKRNQP 131 AGCRPRWSWEPTYTFLGLA PQH K RA KR QP Sbjct: 55 AGCRPRWSWEPTYTFLGLALPQHLKKRRAPKRKQP 89