BLASTX nr result
ID: Coptis23_contig00031157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00031157 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270940.2| PREDICTED: pentatricopeptide repeat-containi... 149 3e-34 ref|XP_003635359.1| PREDICTED: pentatricopeptide repeat-containi... 149 3e-34 emb|CBI41082.3| unnamed protein product [Vitis vinifera] 149 3e-34 emb|CBI28140.3| unnamed protein product [Vitis vinifera] 139 4e-31 ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containi... 139 4e-31 >ref|XP_002270940.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 640 Score = 149 bits (376), Expect = 3e-34 Identities = 68/93 (73%), Positives = 81/93 (87%) Frame = +1 Query: 25 GYKPLISSVLQDMNDKAKEHALAYHSEKLAFAFGLLSTAPGSPIRIVKNLQVCEDCHLAF 204 GY PL +SVLQD ++K KE+ALA+HSEKLA AFGLLSTAPGS IRIVKNL+VC+DCH+A Sbjct: 548 GYAPLTASVLQDFDEKEKENALAHHSEKLAIAFGLLSTAPGSTIRIVKNLRVCDDCHIAI 607 Query: 205 KLLSVIYEWEIIVRDRNRFHHFVGGSCTCRDFW 303 KL+S Y+ IIVRDRNRFHHFV GSC+C+D+W Sbjct: 608 KLISRTYKRRIIVRDRNRFHHFVNGSCSCKDYW 640 >ref|XP_003635359.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like, partial [Vitis vinifera] Length = 115 Score = 149 bits (376), Expect = 3e-34 Identities = 68/93 (73%), Positives = 81/93 (87%) Frame = +1 Query: 25 GYKPLISSVLQDMNDKAKEHALAYHSEKLAFAFGLLSTAPGSPIRIVKNLQVCEDCHLAF 204 GY PL +SVLQD ++K KE+ALA+HSEKLA AFGLLSTAPGS IRIVKNL+VC+DCH+A Sbjct: 23 GYAPLTASVLQDFDEKEKENALAHHSEKLAIAFGLLSTAPGSTIRIVKNLRVCDDCHIAI 82 Query: 205 KLLSVIYEWEIIVRDRNRFHHFVGGSCTCRDFW 303 KL+S Y+ IIVRDRNRFHHFV GSC+C+D+W Sbjct: 83 KLISRTYKRRIIVRDRNRFHHFVNGSCSCKDYW 115 >emb|CBI41082.3| unnamed protein product [Vitis vinifera] Length = 413 Score = 149 bits (376), Expect = 3e-34 Identities = 68/93 (73%), Positives = 81/93 (87%) Frame = +1 Query: 25 GYKPLISSVLQDMNDKAKEHALAYHSEKLAFAFGLLSTAPGSPIRIVKNLQVCEDCHLAF 204 GY PL +SVLQD ++K KE+ALA+HSEKLA AFGLLSTAPGS IRIVKNL+VC+DCH+A Sbjct: 321 GYAPLTASVLQDFDEKEKENALAHHSEKLAIAFGLLSTAPGSTIRIVKNLRVCDDCHIAI 380 Query: 205 KLLSVIYEWEIIVRDRNRFHHFVGGSCTCRDFW 303 KL+S Y+ IIVRDRNRFHHFV GSC+C+D+W Sbjct: 381 KLISRTYKRRIIVRDRNRFHHFVNGSCSCKDYW 413 >emb|CBI28140.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 139 bits (349), Expect = 4e-31 Identities = 64/93 (68%), Positives = 74/93 (79%) Frame = +1 Query: 25 GYKPLISSVLQDMNDKAKEHALAYHSEKLAFAFGLLSTAPGSPIRIVKNLQVCEDCHLAF 204 GY P S VL DM++K KE+ L+ HSEKLA AFGLLST PG+PIR+VKNL+VC DCH A Sbjct: 488 GYVPDKSEVLFDMDEKEKENELSLHSEKLAIAFGLLSTTPGTPIRVVKNLRVCSDCHSAM 547 Query: 205 KLLSVIYEWEIIVRDRNRFHHFVGGSCTCRDFW 303 K +S +Y EIIVRDRNRFHHF GSC+CRDFW Sbjct: 548 KFISEVYNREIIVRDRNRFHHFTKGSCSCRDFW 580 >ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 711 Score = 139 bits (349), Expect = 4e-31 Identities = 64/93 (68%), Positives = 74/93 (79%) Frame = +1 Query: 25 GYKPLISSVLQDMNDKAKEHALAYHSEKLAFAFGLLSTAPGSPIRIVKNLQVCEDCHLAF 204 GY P S VL DM++K KE+ L+ HSEKLA AFGLLST PG+PIR+VKNL+VC DCH A Sbjct: 619 GYVPDKSEVLFDMDEKEKENELSLHSEKLAIAFGLLSTTPGTPIRVVKNLRVCSDCHSAM 678 Query: 205 KLLSVIYEWEIIVRDRNRFHHFVGGSCTCRDFW 303 K +S +Y EIIVRDRNRFHHF GSC+CRDFW Sbjct: 679 KFISEVYNREIIVRDRNRFHHFTKGSCSCRDFW 711