BLASTX nr result
ID: Coptis23_contig00031099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00031099 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67073.1| hypothetical protein VITISV_011746 [Vitis vinifera] 58 9e-07 >emb|CAN67073.1| hypothetical protein VITISV_011746 [Vitis vinifera] Length = 879 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/68 (41%), Positives = 42/68 (61%) Frame = +2 Query: 146 GLYPLQLISNSQQHPTIQXXXXXXXXXXXXYIGEKASSSVWHSRLGHPSLTVLNKIVSKH 325 GLYP+QL S S +G KAS S+WHSRLGH SL +++++++KH Sbjct: 250 GLYPIQLXSMS----------INKSHALSAVVGIKASVSIWHSRLGHASLPIVSQLLNKH 299 Query: 326 SLPIQGTI 349 SLP++G++ Sbjct: 300 SLPVEGSV 307