BLASTX nr result
ID: Coptis23_contig00031059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00031059 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38188.3| unnamed protein product [Vitis vinifera] 66 3e-09 emb|CAN71462.1| hypothetical protein VITISV_018656 [Vitis vinifera] 66 3e-09 ref|XP_002512645.1| pentatricopeptide repeat-containing protein,... 59 4e-07 ref|XP_004152153.1| PREDICTED: putative pentatricopeptide repeat... 58 9e-07 ref|XP_002304652.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 >emb|CBI38188.3| unnamed protein product [Vitis vinifera] Length = 744 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -2 Query: 138 IDLKNLIQGYVQSCRFSEGIELFVRLCREGHELNPFVFTTVIKSFV 1 I LIQGY +S RF E IELFVRL REGHELNPFVFTT++K V Sbjct: 105 ISFVTLIQGYAESVRFLEAIELFVRLHREGHELNPFVFTTILKLLV 150 >emb|CAN71462.1| hypothetical protein VITISV_018656 [Vitis vinifera] Length = 787 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -2 Query: 138 IDLKNLIQGYVQSCRFSEGIELFVRLCREGHELNPFVFTTVIKSFV 1 I LIQGY +S RF E IELFVRL REGHELNPFVFTT++K V Sbjct: 105 ISFVTLIQGYAESVRFLEAIELFVRLHREGHELNPFVFTTILKLLV 150 >ref|XP_002512645.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548606|gb|EEF50097.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 716 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -2 Query: 138 IDLKNLIQGYVQSCRFSEGIELFVRLCREGHELNPFVFTTVIKSFV 1 + LIQGYVQS + E ++LF R+ REGHELNPFVFTT++K V Sbjct: 7 VSFVTLIQGYVQSFQLDEVVDLFSRVHREGHELNPFVFTTILKLLV 52 >ref|XP_004152153.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Cucumis sativus] gi|449515059|ref|XP_004164567.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Cucumis sativus] Length = 721 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = -2 Query: 138 IDLKNLIQGYVQSCRFSEGIELFVRLCREGHELNPFVFTTVIKSFV 1 + LI GY QS +F E ELF RL EGHELNPFVFTTV+K V Sbjct: 12 VSFVTLIHGYAQSNKFIEAFELFARLHGEGHELNPFVFTTVLKLLV 57 >ref|XP_002304652.1| predicted protein [Populus trichocarpa] gi|222842084|gb|EEE79631.1| predicted protein [Populus trichocarpa] Length = 820 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = -2 Query: 138 IDLKNLIQGYVQSCRFSEGIELFVRLCREGHELNPFVFTTVIKSFV 1 + LIQGY Q RFSE I LF RL EGHELNPFVF+TV+K V Sbjct: 111 VSFVTLIQGYSQCLRFSEAIGLFSRLQGEGHELNPFVFSTVLKLLV 156