BLASTX nr result
ID: Coptis23_contig00030963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00030963 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612528.1| Alkylated DNA repair protein alkB-like prote... 91 1e-16 ref|NP_973945.1| RNA recognition motif-containing protein [Arabi... 90 2e-16 dbj|BAD93744.1| hypothetical protein [Arabidopsis thaliana] 90 2e-16 ref|NP_174442.2| RNA recognition motif-containing protein [Arabi... 90 2e-16 ref|XP_003534335.1| PREDICTED: alkylated DNA repair protein alkB... 89 4e-16 >ref|XP_003612528.1| Alkylated DNA repair protein alkB-like protein [Medicago truncatula] gi|355513863|gb|AES95486.1| Alkylated DNA repair protein alkB-like protein [Medicago truncatula] Length = 344 Score = 90.5 bits (223), Expect = 1e-16 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +3 Query: 3 WHHYIPHHKVDAVRGNIIKRSSRRVSFTLRKVRNGPCCCEFPQYCDSQ 146 WHHYIPHHK+D V G +I+R+SRRVSFTLRKVR G C CEFPQYCDSQ Sbjct: 296 WHHYIPHHKIDKVDGKVIRRASRRVSFTLRKVRAGLCKCEFPQYCDSQ 343 >ref|NP_973945.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|332193254|gb|AEE31375.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 344 Score = 89.7 bits (221), Expect = 2e-16 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +3 Query: 3 WHHYIPHHKVDAVRGNIIKRSSRRVSFTLRKVRNGPCCCEFPQYCDSQ 146 W+HYIPHHK+D V+ +I+RSSRRVSFTLRKVRN PC C++PQYCDSQ Sbjct: 294 WNHYIPHHKIDKVKDKVIRRSSRRVSFTLRKVRNHPCSCKYPQYCDSQ 341 >dbj|BAD93744.1| hypothetical protein [Arabidopsis thaliana] Length = 431 Score = 89.7 bits (221), Expect = 2e-16 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +3 Query: 3 WHHYIPHHKVDAVRGNIIKRSSRRVSFTLRKVRNGPCCCEFPQYCDSQ 146 W+HYIPHHK+D V+ +I+RSSRRVSFTLRKVRN PC C++PQYCDSQ Sbjct: 381 WNHYIPHHKIDKVKDKVIRRSSRRVSFTLRKVRNHPCSCKYPQYCDSQ 428 >ref|NP_174442.2| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|42571711|ref|NP_973946.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|20259468|gb|AAM13854.1| unknown protein [Arabidopsis thaliana] gi|22136680|gb|AAM91659.1| unknown protein [Arabidopsis thaliana] gi|332193253|gb|AEE31374.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|332193255|gb|AEE31376.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 431 Score = 89.7 bits (221), Expect = 2e-16 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +3 Query: 3 WHHYIPHHKVDAVRGNIIKRSSRRVSFTLRKVRNGPCCCEFPQYCDSQ 146 W+HYIPHHK+D V+ +I+RSSRRVSFTLRKVRN PC C++PQYCDSQ Sbjct: 381 WNHYIPHHKIDKVKDKVIRRSSRRVSFTLRKVRNHPCSCKYPQYCDSQ 428 >ref|XP_003534335.1| PREDICTED: alkylated DNA repair protein alkB homolog 8-like [Glycine max] Length = 342 Score = 89.0 bits (219), Expect = 4e-16 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +3 Query: 3 WHHYIPHHKVDAVRGNIIKRSSRRVSFTLRKVRNGPCCCEFPQYCDSQ 146 WHHYIPHHK+D V G +I+R+SRRVSFT RKVR G C CEFPQYCDS+ Sbjct: 294 WHHYIPHHKIDKVNGKVIRRASRRVSFTFRKVREGLCKCEFPQYCDSR 341