BLASTX nr result
ID: Coptis23_contig00030911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00030911 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168018.1| PREDICTED: WRKY transcription factor 55-like... 57 1e-06 ref|XP_004146468.1| PREDICTED: WRKY transcription factor 55-like... 57 1e-06 gb|AAG35659.1|AF204926_1 transcription factor WRKY5 [Petroselinu... 57 2e-06 ref|XP_002520872.1| hypothetical protein RCOM_0689810 [Ricinus c... 55 6e-06 gb|AER70304.1| WRKY transcription factor [(Populus tomentosa x P... 55 8e-06 >ref|XP_004168018.1| PREDICTED: WRKY transcription factor 55-like, partial [Cucumis sativus] Length = 178 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 3/42 (7%) Frame = -2 Query: 122 RRKHGHENRTVRVATAQSG---IPPDDGFSWRKYGQKEILGS 6 RRK E RTVRV + G +PPDDGF+WRKYGQKEILGS Sbjct: 134 RRKDDTEKRTVRVGAPRIGNTELPPDDGFTWRKYGQKEILGS 175 >ref|XP_004146468.1| PREDICTED: WRKY transcription factor 55-like [Cucumis sativus] Length = 317 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 3/42 (7%) Frame = -2 Query: 122 RRKHGHENRTVRVATAQSG---IPPDDGFSWRKYGQKEILGS 6 RRK E RTVRV + G +PPDDGF+WRKYGQKEILGS Sbjct: 134 RRKDDTEKRTVRVGAPRIGNTELPPDDGFTWRKYGQKEILGS 175 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 392 HKLINGCSATKLVQRLDNDPHMFEVTYRGHHVCQISQTA 276 H+ + C A K VQRLD+DPH FEVTYRG H C +S TA Sbjct: 186 HQKLYHCPAKKHVQRLDDDPHTFEVTYRGEHTCHMSATA 224 >gb|AAG35659.1|AF204926_1 transcription factor WRKY5 [Petroselinum crispum] Length = 353 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/46 (60%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Frame = -2 Query: 134 QTLPRRKHGHENRTVRVATAQSG---IPPDDGFSWRKYGQKEILGS 6 Q + RRK + R+VRV Q G IPP+DGF+WRKYGQKEILGS Sbjct: 120 QRMRRRKDDADKRSVRVPAPQMGNTEIPPEDGFTWRKYGQKEILGS 165 >ref|XP_002520872.1| hypothetical protein RCOM_0689810 [Ricinus communis] gi|223540003|gb|EEF41581.1| hypothetical protein RCOM_0689810 [Ricinus communis] Length = 331 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 3/46 (6%) Frame = -2 Query: 134 QTLPRRKHGHENRTVRVATAQSG---IPPDDGFSWRKYGQKEILGS 6 Q L RRK E RT RV + G IPP+DG++WRKYGQKEILGS Sbjct: 146 QRLRRRKDEGEKRTERVPAPRMGNTEIPPEDGYTWRKYGQKEILGS 191 >gb|AER70304.1| WRKY transcription factor [(Populus tomentosa x P. bolleana) x P. tomentosa] Length = 370 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = -2 Query: 104 ENRTVRVATAQSG---IPPDDGFSWRKYGQKEILGS 6 E RTVRV Q G IPP+DGFSWRKYGQKEILGS Sbjct: 167 EKRTVRVPAQQFGNTEIPPEDGFSWRKYGQKEILGS 202