BLASTX nr result
ID: Coptis23_contig00030851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00030851 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002446818.1| hypothetical protein SORBIDRAFT_06g023130 [S... 71 1e-10 ref|NP_200004.1| transcription factor TCP19 [Arabidopsis thalian... 70 2e-10 ref|XP_002865882.1| hypothetical protein ARALYDRAFT_495258 [Arab... 70 2e-10 gb|AAM64446.1| unknown [Arabidopsis thaliana] 70 2e-10 ref|XP_002519510.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 >ref|XP_002446818.1| hypothetical protein SORBIDRAFT_06g023130 [Sorghum bicolor] gi|241938001|gb|EES11146.1| hypothetical protein SORBIDRAFT_06g023130 [Sorghum bicolor] Length = 192 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -3 Query: 371 RHLKVNGRGRRVRIPGGCLPRIFELTSQLGYQYDGQTIEWLLHRAE 234 RH KVNGRGRRVR+P C R+F+LT +LG + DGQTIEWLLH+AE Sbjct: 38 RHSKVNGRGRRVRMPIVCAARVFQLTRELGLKSDGQTIEWLLHQAE 83 >ref|NP_200004.1| transcription factor TCP19 [Arabidopsis thaliana] gi|30696122|ref|NP_851173.1| transcription factor TCP19 [Arabidopsis thaliana] gi|75180423|sp|Q9LT89.1|TCP19_ARATH RecName: Full=Transcription factor TCP19 gi|8809685|dbj|BAA97226.1| unnamed protein product [Arabidopsis thaliana] gi|26452182|dbj|BAC43179.1| unknown protein [Arabidopsis thaliana] gi|31711724|gb|AAP68218.1| At5g51910 [Arabidopsis thaliana] gi|332008761|gb|AED96144.1| transcription factor TCP19 [Arabidopsis thaliana] gi|332008762|gb|AED96145.1| transcription factor TCP19 [Arabidopsis thaliana] Length = 293 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -3 Query: 371 RHLKVNGRGRRVRIPGGCLPRIFELTSQLGYQYDGQTIEWLLHRAE 234 RH KV GRGRR+R+P GC R+F+LT +LG++ DG+TI WLL RAE Sbjct: 60 RHTKVEGRGRRIRMPAGCAARVFQLTRELGHKSDGETIRWLLERAE 105 >ref|XP_002865882.1| hypothetical protein ARALYDRAFT_495258 [Arabidopsis lyrata subsp. lyrata] gi|297311717|gb|EFH42141.1| hypothetical protein ARALYDRAFT_495258 [Arabidopsis lyrata subsp. lyrata] Length = 299 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -3 Query: 371 RHLKVNGRGRRVRIPGGCLPRIFELTSQLGYQYDGQTIEWLLHRAE 234 RH KV GRGRR+R+P GC R+F+LT +LG++ DG+TI WLL RAE Sbjct: 60 RHTKVEGRGRRIRMPAGCAARVFQLTRELGHKSDGETIRWLLERAE 105 >gb|AAM64446.1| unknown [Arabidopsis thaliana] Length = 260 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -3 Query: 371 RHLKVNGRGRRVRIPGGCLPRIFELTSQLGYQYDGQTIEWLLHRAE 234 RH KV GRGRR+R+P GC R+F+LT +LG++ DG+TI WLL RAE Sbjct: 27 RHTKVEGRGRRIRMPAGCAARVFQLTRELGHKSDGETIRWLLERAE 72 >ref|XP_002519510.1| conserved hypothetical protein [Ricinus communis] gi|223541373|gb|EEF42924.1| conserved hypothetical protein [Ricinus communis] Length = 215 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -3 Query: 371 RHLKVNGRGRRVRIPGGCLPRIFELTSQLGYQYDGQTIEWLLHRAE 234 RH KVNGRGRRVR+P C RIF+LT +LG++ DG+TIEWLL +AE Sbjct: 51 RHTKVNGRGRRVRMPALCAARIFQLTRELGHRSDGETIEWLLRQAE 96