BLASTX nr result
ID: Coptis23_contig00030776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00030776 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25119.3| unnamed protein product [Vitis vinifera] 60 1e-07 emb|CAN75064.1| hypothetical protein VITISV_025472 [Vitis vinifera] 60 1e-07 >emb|CBI25119.3| unnamed protein product [Vitis vinifera] Length = 173 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 130 RKSFNGNPLTKSSILTNPRSFHSATPANSPSDLSRRSSGCKEG 2 R+SF+GNP TK SI+ NPR F+ TPANSPSD RR S KEG Sbjct: 32 RRSFSGNPFTKPSIVANPRGFNPVTPANSPSDFPRRYSIAKEG 74 >emb|CAN75064.1| hypothetical protein VITISV_025472 [Vitis vinifera] Length = 1013 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 130 RKSFNGNPLTKSSILTNPRSFHSATPANSPSDLSRRSSGCKEG 2 R+SF+GNP TK SI+ NPR F+ TPANSPSD RR S KEG Sbjct: 32 RRSFSGNPFTKPSIVANPRGFNPVTPANSPSDFPRRYSIAKEG 74