BLASTX nr result
ID: Coptis23_contig00030568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00030568 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511627.1| pentatricopeptide repeat-containing protein,... 46 4e-09 ref|XP_004142707.1| PREDICTED: pentatricopeptide repeat-containi... 43 1e-06 ref|XP_004161177.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 43 1e-06 >ref|XP_002511627.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548807|gb|EEF50296.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1163 Score = 45.8 bits (107), Expect(2) = 4e-09 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 7/62 (11%) Frame = +3 Query: 78 LICNVPQKEEVERALELFDELLQNETIV*DEGCVPYA*A-------LV*KEKTKKAERVF 236 LI N+ Q+ ERA +LFDEL + E ++ D+GC P A L KT KAERVF Sbjct: 411 LIRNLCQRGNFERAEQLFDELSEKEILLRDDGCTPLVAAYKSMFEFLCRNGKTAKAERVF 470 Query: 237 KQ 242 +Q Sbjct: 471 RQ 472 Score = 39.7 bits (91), Expect(2) = 4e-09 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = +2 Query: 242 VLKKGRQDPPAFRTVIPGHCKRRTFEADY 328 ++K+G QDP +F+ +I GHC+ TFEA Y Sbjct: 473 LMKRGTQDPLSFKILIKGHCREGTFEAGY 501 >ref|XP_004142707.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Cucumis sativus] Length = 757 Score = 43.1 bits (100), Expect(2) = 1e-06 Identities = 15/29 (51%), Positives = 24/29 (82%) Frame = +2 Query: 242 VLKKGRQDPPAFRTVIPGHCKRRTFEADY 328 ++++G QDPP+++T+I GHCK TFE+ Y Sbjct: 466 LMRRGTQDPPSYKTLIMGHCKEGTFESGY 494 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%) Frame = +3 Query: 78 LICNVPQKEEVERALELFDELLQNETIV*DEGCVPYA*A-------LV*KEKTKKAERVF 236 L+ ++ Q E+A +L D+LL+ + ++ +GC P A L KTKKAE+ F Sbjct: 404 LVRSLCQGGHYEKAEDLLDKLLERKILLSGDGCKPLVAAYNPIFKYLCETGKTKKAEKAF 463 Query: 237 KQY*RK 254 +Q R+ Sbjct: 464 RQLMRR 469 >ref|XP_004161177.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Cucumis sativus] Length = 720 Score = 43.1 bits (100), Expect(2) = 1e-06 Identities = 15/29 (51%), Positives = 24/29 (82%) Frame = +2 Query: 242 VLKKGRQDPPAFRTVIPGHCKRRTFEADY 328 ++++G QDPP+++T+I GHCK TFE+ Y Sbjct: 466 LMRRGTQDPPSYKTLIMGHCKEGTFESGY 494 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%) Frame = +3 Query: 78 LICNVPQKEEVERALELFDELLQNETIV*DEGCVPYA*A-------LV*KEKTKKAERVF 236 L+ ++ Q E+A +L D+LL+ + ++ +GC P A L KTKKAE+ F Sbjct: 404 LVRSLCQGGHYEKAEDLLDKLLERKILLSGDGCKPLVAAYNPIFKYLCETGKTKKAEKAF 463 Query: 237 KQY*RK 254 +Q R+ Sbjct: 464 RQLMRR 469