BLASTX nr result
ID: Coptis23_contig00030386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00030386 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 ref|XP_003541672.1| PREDICTED: pentatricopeptide repeat-containi... 68 7e-10 ref|XP_002324235.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 >ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Brachypodium distachyon] Length = 598 Score = 69.7 bits (169), Expect = 2e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 5 HSAMKLISKVFNRLIVIRDRSRFHHFSGGLCSCKDYW 115 H A+KLISKV++R I++RDRSRFHHF GG CSCKDYW Sbjct: 562 HMAIKLISKVYDREIIVRDRSRFHHFKGGACSCKDYW 598 >ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Brachypodium distachyon] Length = 745 Score = 68.9 bits (167), Expect = 4e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 5 HSAMKLISKVFNRLIVIRDRSRFHHFSGGLCSCKDYW 115 HSA KLISKV+NR I++RDR+RFHHF GLCSC DYW Sbjct: 709 HSATKLISKVYNREIIVRDRNRFHHFKDGLCSCNDYW 745 >ref|XP_003541672.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 591 Score = 68.2 bits (165), Expect = 7e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 5 HSAMKLISKVFNRLIVIRDRSRFHHFSGGLCSCKDYW 115 H A+KLI+K+++R IVIRDRSRFHHF GG CSCKDYW Sbjct: 555 HMAIKLIAKIYDREIVIRDRSRFHHFRGGSCSCKDYW 591 >ref|XP_002324235.1| predicted protein [Populus trichocarpa] gi|222865669|gb|EEF02800.1| predicted protein [Populus trichocarpa] Length = 736 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 5 HSAMKLISKVFNRLIVIRDRSRFHHFSGGLCSCKDYW 115 HSA KLISK+FNR I+ RDR+RFHHF G CSCKDYW Sbjct: 700 HSATKLISKIFNREIIARDRNRFHHFKDGSCSCKDYW 736 >ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] Length = 613 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 5 HSAMKLISKVFNRLIVIRDRSRFHHFSGGLCSCKDYW 115 H A+KLISKVF+R IV+RDRSRFHHF G CSCKDYW Sbjct: 577 HLAIKLISKVFDREIVVRDRSRFHHFKDGHCSCKDYW 613