BLASTX nr result
ID: Coptis23_contig00030141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00030141 (478 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272525.2| PREDICTED: putative pentatricopeptide repeat... 59 4e-07 emb|CBI34855.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_003525738.1| PREDICTED: putative pentatricopeptide repeat... 55 8e-06 >ref|XP_002272525.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Vitis vinifera] Length = 1291 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 4/51 (7%) Frame = -3 Query: 239 KSEKKIGSNMFVGSAFTEFYSKCREMGDDLRVSE----PDVVL*TSMVTGY 99 K +IGS+MFVGSA E YSKC +MG+ L+V E PD VL TSMVTGY Sbjct: 130 KKNDEIGSDMFVGSALVELYSKCGQMGEALKVFEEFQRPDTVLWTSMVTGY 180 >emb|CBI34855.3| unnamed protein product [Vitis vinifera] Length = 956 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 4/51 (7%) Frame = -3 Query: 239 KSEKKIGSNMFVGSAFTEFYSKCREMGDDLRVSE----PDVVL*TSMVTGY 99 K +IGS+MFVGSA E YSKC +MG+ L+V E PD VL TSMVTGY Sbjct: 130 KKNDEIGSDMFVGSALVELYSKCGQMGEALKVFEEFQRPDTVLWTSMVTGY 180 >ref|XP_003525738.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580-like [Glycine max] Length = 701 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 4/49 (8%) Frame = -3 Query: 233 EKKIGSNMFVGSAFTEFYSKCREMGDDLRV----SEPDVVL*TSMVTGY 99 +KKI S+MFVGSA E YSKC +M D ++V +PDVVL TS++TGY Sbjct: 132 KKKIDSDMFVGSALIELYSKCGQMNDAVKVFTEYPKPDVVLWTSIITGY 180