BLASTX nr result
ID: Coptis23_contig00029950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029950 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528173.1| Disease resistance protein RFL1, putative [R... 57 1e-06 ref|XP_002278676.2| PREDICTED: probable disease resistance prote... 57 2e-06 >ref|XP_002528173.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532385|gb|EEF34180.1| Disease resistance protein RFL1, putative [Ricinus communis] Length = 881 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/51 (45%), Positives = 34/51 (66%) Frame = +1 Query: 88 LCKSALHFPSIK*MKSYKCLSLRRLPLQSDSCQNRLQFIGGDPDWWNNLEW 240 +C+ AL FPS++ + Y+C LR+LP SDS + L+ I G +WWN L+W Sbjct: 814 ICRQALSFPSLEKITVYECPRLRKLPFNSDSARTSLKEIRGKENWWNGLQW 864 >ref|XP_002278676.2| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Length = 895 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 5/66 (7%) Frame = +1 Query: 58 QVQG*KLHFC-----LCKSALHFPSIK*MKSYKCLSLRRLPLQSDSCQNRLQFIGGDPDW 222 +++G LH+ + + AL FPS+K ++ KC +LR+LPL S+S +N L+ I G +W Sbjct: 798 RLEGLTLHYLPNLRSISRRALPFPSLKTLRVTKCPNLRKLPLDSNSARNSLKIIEGTSEW 857 Query: 223 WNNLEW 240 W L+W Sbjct: 858 WRGLQW 863