BLASTX nr result
ID: Coptis23_contig00029908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029908 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533435.1| PREDICTED: uncharacterized protein LOC100808... 52 6e-06 >ref|XP_003533435.1| PREDICTED: uncharacterized protein LOC100808015 [Glycine max] Length = 730 Score = 51.6 bits (122), Expect(2) = 6e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -3 Query: 104 YMQLWYTGLTSCSGHYFCFIRSSPQT*HKLDDS 6 Y + +TGL+S SGHYFCF+RS+P T HKLDDS Sbjct: 378 YAIVVHTGLSSTSGHYFCFVRSAPDTWHKLDDS 410 Score = 23.1 bits (48), Expect(2) = 6e-06 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = -2 Query: 114 KYELYAVVVH 85 KY+LYA+VVH Sbjct: 374 KYDLYAIVVH 383